Protein Info for GFF3843 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: membrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 292 transmembrane" amino acids 7 to 26 (20 residues), see Phobius details amino acids 35 to 54 (20 residues), see Phobius details amino acids 63 to 84 (22 residues), see Phobius details amino acids 106 to 133 (28 residues), see Phobius details amino acids 151 to 169 (19 residues), see Phobius details amino acids 179 to 198 (20 residues), see Phobius details amino acids 209 to 232 (24 residues), see Phobius details amino acids 239 to 259 (21 residues), see Phobius details amino acids 270 to 291 (22 residues), see Phobius details PF03547: Mem_trans" amino acids 149 to 286 (138 residues), 51.6 bits, see alignment E=2.8e-18

Best Hits

KEGG orthology group: K07088, (no description) (inferred from 50% identity to reu:Reut_A0908)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (292 amino acids)

>GFF3843 membrane protein (Hydrogenophaga sp. GW460-11-11-14-LB1)
MDLIARIADVIIPVFLIVAIGFAYARRQTPDMGTFNRIALDVLAPVLVYSALASRDFVIA
EHLVLLAGGAVIILGGGLLAWPLARAFGAQPRTLVPVVMFNNCGNMGLPLALLAFGPAHF
GAAVALFSVSNLLHFSVGSRITSRLARTRDLLTSPLMIGTALGFASALTDVRPPDVVLAG
LKLLGDALLPMMLFALGVRLTALTRQGLALGLLGALARPLIGLAIALPLAWALGLEGAAR
GQLLLFAALPPAVMQFMLADRYHQEPDKVGAMIMLGNALAVVFVPLALALAL