Protein Info for GFF3841 in Xanthobacter sp. DMC5

Annotation: UDP-N-acetylglucosamine 2-epimerase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 385 TIGR00236: UDP-N-acetylglucosamine 2-epimerase" amino acids 1 to 351 (351 residues), 440 bits, see alignment E=3.8e-136 PF02350: Epimerase_2" amino acids 7 to 352 (346 residues), 388.4 bits, see alignment E=1.4e-120

Best Hits

Swiss-Prot: 57% identical to WECB_ECOLI: UDP-N-acetylglucosamine 2-epimerase (wecB) from Escherichia coli (strain K12)

KEGG orthology group: K01791, UDP-N-acetylglucosamine 2-epimerase [EC: 5.1.3.14] (inferred from 78% identity to xau:Xaut_1736)

MetaCyc: 57% identical to UDP-N-acetylglucosamine 2-epimerase (Escherichia coli K-12 substr. MG1655)
UDP-N-acetylglucosamine 2-epimerase. [EC: 5.1.3.14]

Predicted SEED Role

"UDP-N-acetylglucosamine 2-epimerase (EC 5.1.3.14)" in subsystem CMP-N-acetylneuraminate Biosynthesis or Sialic Acid Metabolism (EC 5.1.3.14)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 5.1.3.14

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (385 amino acids)

>GFF3841 UDP-N-acetylglucosamine 2-epimerase (Xanthobacter sp. DMC5)
MAPVVQALAREPAVQSLVCVTGQHREMLDQVLRLFDLTPDFDLGLMAHNQGLNRLAGGAL
SALDSVLADVKPDRVLVHGDTTTAMAAALAAFHRRIPVGHVEAGLRTYDLGQPFPEEMNR
RIADLCSDLLFAPTAGSRDNLLSEQLEGQVFVTGNTVIDALQSVQRRLDADPDLRSALDA
ELPPLDPRRPILLVTGHRRENFGEGFRNICEALDEIADRGDVEIVYPVHLNPNVKGPVTA
ALAGRPNVHLVPPLDYLPFQRLMQRSHLVLTDSGGVQEEAPALGKPVLVMREVTERPEAV
HAGTVQLVGTGRAAIVNAVSRLLDDPVAYAAYAGRINPYGDGQACRRIVDCICGRPVQEF
SPLQSPPAASAPRRPAGLDAMLVRD