Protein Info for GFF3832 in Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868

Annotation: FIG01045739: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

No protein families (PFam or TIGRFam), signal peptides, or transmembrane helices were found in this protein.

Best Hits

KEGG orthology group: None (inferred from 92% identity to sea:SeAg_B2292)

Predicted SEED Role

"FIG01045739: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (61 amino acids)

>GFF3832 FIG01045739: hypothetical protein (Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868)
VQQHIRQQVCQNRIGFENYLITLKLSSAADCKFTLSGTDSMLNSETPLNTVGLDDSGCPS
L