Protein Info for GFF3831 in Variovorax sp. SCN45

Annotation: Acetyltransferase, GNAT family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 174 PF13420: Acetyltransf_4" amino acids 20 to 167 (148 residues), 52.9 bits, see alignment E=1.1e-17 PF13302: Acetyltransf_3" amino acids 37 to 148 (112 residues), 27.6 bits, see alignment E=1.1e-09 PF00583: Acetyltransf_1" amino acids 44 to 147 (104 residues), 60.3 bits, see alignment E=5.5e-20 PF13673: Acetyltransf_10" amino acids 48 to 154 (107 residues), 27.2 bits, see alignment E=8.7e-10 PF13508: Acetyltransf_7" amino acids 63 to 148 (86 residues), 33.9 bits, see alignment E=8.3e-12

Best Hits

Swiss-Prot: 53% identical to PAT_ALCFA: Phosphinothricin N-acetyltransferase (pat) from Alcaligenes faecalis

KEGG orthology group: K03823, phosphinothricin acetyltransferase [EC: 2.3.1.183] (inferred from 78% identity to vpe:Varpa_1508)

Predicted SEED Role

"GCN5-related N-acetyltransferase"

MetaCyc Pathways

Isozymes

Compare fitness of predicted isozymes for: 2.3.1.183

Use Curated BLAST to search for 2.3.1.183

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (174 amino acids)

>GFF3831 Acetyltransferase, GNAT family (Variovorax sp. SCN45)
MSSPSIASTAVTVIDAEPHHMAAVQAIYSHYVLHDLCSFEEEVPTTQQMLARRADVAARG
LPYLVALKDGKVAGYAYATAYRARSAYRHTVEDSVYVAQGMHGHGIGTALLRAVIQRCTD
GGFSQMVACVGNSANLGSQRLHGSLGFEQVGVLREVGFKFGQWMDTVLMQRALR