Protein Info for GFF383 in Xanthobacter sp. DMC5

Annotation: Peptidyl-prolyl cis-trans isomerase B

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 152 PF00160: Pro_isomerase" amino acids 7 to 145 (139 residues), 139.9 bits, see alignment E=4.4e-45

Best Hits

Swiss-Prot: 43% identical to PPIA_HELPY: Peptidyl-prolyl cis-trans isomerase (ppiA) from Helicobacter pylori (strain ATCC 700392 / 26695)

KEGG orthology group: K01802, peptidylprolyl isomerase [EC: 5.2.1.8] (inferred from 92% identity to xau:Xaut_3789)

MetaCyc: 61% identical to glucuronan lyase (Sinorhizobium meliloti Rm2011)
Glucuronan lyase. [EC: 4.2.2.14]

Predicted SEED Role

"Peptidyl-prolyl cis-trans isomerase (EC 5.2.1.8)" in subsystem Queuosine-Archaeosine Biosynthesis (EC 5.2.1.8)

Isozymes

Compare fitness of predicted isozymes for: 5.2.1.8

Use Curated BLAST to search for 4.2.2.14 or 5.2.1.8

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (152 amino acids)

>GFF383 Peptidyl-prolyl cis-trans isomerase B (Xanthobacter sp. DMC5)
MSDEVLILETTKGPVTIAFRPDLAPGHVARIKELVSQGFYNGVPFHRVIEGFMAQTGDPT
GTGMGGSGKKLKAEFNAQPHVRGTCSMARAQNPDSGDSQFFICFTDARFLDRQYTVWGEV
IDGMDNIDQIKRGEPVKDPDKIVTAKLAPKAA