Protein Info for GFF383 in Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868

Annotation: Lipopolysaccharide 1,6-galactosyltransferase (EC 2.4.1.-)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF13439: Glyco_transf_4
  • amino acids 14 to 167 (154 residues), 29.2 bits, E=1.4e-10
• PF00534: Glycos_transf_1
  • amino acids 175 to 334 (160 residues), 111.7 bits, E=4.4e-36
• PF13692: Glyco_trans_1_4
  • amino acids 182 to 322 (141 residues), 80.5 bits, E=2.2e-26

Best Hits

Swiss-Prot: 100% identical to RFAB_SALTY: Lipopolysaccharide 1,6-galactosyltransferase (rfaB) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: K02840, UDP-D-galactose:(glucosyl)LPS alpha-1,6-D-galactosyltransferase [EC: 2.4.1.-] (inferred from 98% identity to sew:SeSA_A3918)

MetaCyc: 100% identical to lipopolysaccharide alpha-(1,6)-galactosyltransferase (Salmonella enterica enterica serovar Typhimurium str. LT2)
2.4.1.-

Predicted SEED Role

"Lipopolysaccharide 1,6-galactosyltransferase (EC 2.4.1.-)" in subsystem LOS core oligosaccharide biosynthesis (EC 2.4.1.-)

MetaCyc Pathways

• superpathway of Kdo₂-lipid A biosynthesis (23/25 steps found)
• lipid A-core biosynthesis (Salmonella) (10/10 steps found)
• lipid A-core biosynthesis (E. coli K-12) (8/10 steps found)

KEGG Metabolic Maps

• Anthocyanin biosynthesis
• Carotenoid biosynthesis - General
• Flavone and flavonol biosynthesis
• Flavonoid biosynthesis
• Fructose and mannose metabolism
• Glycerolipid metabolism
• Glycosphingolipid biosynthesis - ganglio series
• Glycosphingolipid biosynthesis - globo series
• Glycosphingolipid biosynthesis - lacto and neolacto series
• Glycosylphosphatidylinositol(GPI)-anchor biosynthesis
• High-mannose type N-glycan biosynthesis
• Keratan sulfate biosynthesis
• Lipopolysaccharide biosynthesis
• N-Glycan biosynthesis
• O-Glycan biosynthesis
• O-Mannosyl glycan biosynthesis
• Peptidoglycan biosynthesis
• Sphingolipid metabolism
• Zeatin biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 2.4.1.-

Use Curated BLAST to search for 2.4.1.-

Protein Sequence (359 amino acids)

>GFF383 Lipopolysaccharide 1,6-galactosyltransferase (EC 2.4.1.-) (Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868)
MKIAFIGEAVSGFGGMETVISNVIHTFENSSPKINCEMFFFCRNDKMDKAWLKEIKYAQS
FSNIKLSFLRRAKHVYNFSQWLKETSPDIVICIDVISCLYANKARKKSGKHFTIFSWPHF
SLDHKKHAECITYADYHLAISSGIKEQIMARGISAQDISVVYNPVSIKTVIVPPPERDKP
AVFLYVGRLKFEGQKRVKDLFDGLARTTGEWQLHIIGDGSDFEKCQAYSRELGIEQRVIW
YGWQSAPWQVVQQKIKNVTALLLTSAFEGFPMTLLEAMSYGIPCISSDCMSGPRDMIKPG
LNGELYTPGAIDDFVGHLNRVISGEVKYQHDIIPGTIERFYDVLYFKNFNNAIFSKLQK