Protein Info for GFF3826 in Variovorax sp. SCN45

Annotation: Response regulator receiver:LytTr DNA-binding region

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 251 PF00072: Response_reg" amino acids 9 to 119 (111 residues), 94.1 bits, see alignment E=6.4e-31 PF04397: LytTR" amino acids 150 to 247 (98 residues), 67.8 bits, see alignment E=8.1e-23

Best Hits

KEGG orthology group: K08083, two-component system, LytT family, response regulator AlgR (inferred from 95% identity to vap:Vapar_1363)

Predicted SEED Role

"Autolysis response regulater LytR" in subsystem Murein hydrolase regulation and cell death

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (251 amino acids)

>GFF3826 Response regulator receiver:LytTr DNA-binding region (Variovorax sp. SCN45)
MNMSTLKTLIVDDEALARSRLRTLLRDCNSPGAEVVAEAAQGAEAQQQLATLALDLVLLD
VHMPGIDGIEVARALRSRADAPAVVFVTAHAAHAVTAFDLDAVDYLTKPVRAERLQQALQ
KAERFLKERRALQAEAAPETVLIQDRGRAERVPLSEVLYLKSEYKYLTVRTATRSHILDG
SLNEFEERYPHRFLRVHRNALVARAAIRALEKYDDGEDAEGWALRLDAIPEPVAVSRRQL
AAVREVIKEAR