Protein Info for GFF3823 in Xanthobacter sp. DMC5

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 800 848 transmembrane" amino acids 26 to 50 (25 residues), see Phobius details amino acids 266 to 286 (21 residues), see Phobius details amino acids 318 to 348 (31 residues), see Phobius details amino acids 360 to 383 (24 residues), see Phobius details amino acids 403 to 425 (23 residues), see Phobius details amino acids 431 to 457 (27 residues), see Phobius details amino acids 480 to 502 (23 residues), see Phobius details amino acids 654 to 674 (21 residues), see Phobius details amino acids 725 to 746 (22 residues), see Phobius details amino acids 773 to 798 (26 residues), see Phobius details amino acids 812 to 837 (26 residues), see Phobius details PF02687: FtsX" amino acids 269 to 382 (114 residues), 39.7 bits, see alignment E=2.3e-14 amino acids 728 to 841 (114 residues), 47 bits, see alignment E=1.3e-16

Best Hits

KEGG orthology group: K02004, (no description) (inferred from 79% identity to xau:Xaut_1757)

Predicted SEED Role

"ABC transporter, permease protein, putative"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (848 amino acids)

>GFF3823 hypothetical protein (Xanthobacter sp. DMC5)
MSLASARLPVPLRLALRELRGARRGFGIFLGCLVLGVAAIAGIGSFAGALTQGLEREGRA
ILGGDAGFSVVQREMTAEERASLDRHGTLGSVALLRAMARTEAGDASLAELKAVDGTYPL
VGTVGLDPPMPVADALKEKNGVFGAAADPVLLGRLGVKTGDRIRVGDATLEIRAALASEP
DKLSSGVGLGARLLISQAALPATGLIQPGSLVRWSYRLLLDNPAPENLKAVMEEVREPMG
RAGFEVRTRDGATPQLARNVGRISQFLTLVALTALLVGGVGVANAVSSHLAGKLEVIATL
KAVGATRRDVFLTYGAEIGLIAAFGIVLGLMLGAALPFAATAAIGALVPFPLDPRIDGAA
LARAALYGLVVAAVFSVIPLARAQEARVSALFRDGIGEMRRRISLPYLLLVGGLGAALVV
LALFTSDDKRAAAIFLAAAAAVFVLLRLVASGLMALARRAPRPRGAAARLALGNIHRPGA
LTPSVVLSLGLGLSLLVGISLVDASLNRELNGPVRESAPSFFFVDVPNSEEAEFRAFLAE
QAPGAVVKSVPMLRGRITHVKDIPAEEVKPRPDAAWVLQSDRGISSSATVPEGSTVVAGT
WWTGDETEPLVSFDSELAAGLGLKLGDTVTVSVLGRSVTARIANLRQVKWERLGINFVMV
FSPATFAGAPYTVLSTLAFPDGGDTAREISLLKAMAARFPAITTVRVKETLEEAQRMLDN
LSLGIRAASLVTLITSVLVLAGALAAGRERRIYDAVILKTLGATRGRLTLAYGLEYAGLG
LATAIVAAAAGTAAAWGVVTQVMDIPFTFAPLPAFGAVAAALAVTLVVGLLGTLRALSAP
PARVLRHL