Protein Info for GFF3822 in Sphingobium sp. HT1-2

Annotation: Sensor histidine kinase ChvG (EC 2.7.3.-)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 531 transmembrane" amino acids 28 to 47 (20 residues), see Phobius details amino acids 220 to 239 (20 residues), see Phobius details PF13755: Sensor_TM1" amino acids 24 to 70 (47 residues), 28.6 bits, see alignment 2e-10 PF00672: HAMP" amino acids 237 to 292 (56 residues), 41.2 bits, see alignment 3.3e-14 PF00512: HisKA" amino acids 299 to 360 (62 residues), 46.9 bits, see alignment E=4.7e-16 PF02518: HATPase_c" amino acids 409 to 521 (113 residues), 80.5 bits, see alignment E=2.5e-26

Best Hits

KEGG orthology group: K14980, two-component system, OmpR family, sensor histidine kinase ChvG [EC: 2.7.13.3] (inferred from 89% identity to sjp:SJA_C1-10790)

Predicted SEED Role

"Sensor histidine kinase ChvG (EC 2.7.3.-)" (EC 2.7.3.-)

Isozymes

Compare fitness of predicted isozymes for: 2.7.13.3, 2.7.3.-

Use Curated BLAST to search for 2.7.13.3 or 2.7.3.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (531 amino acids)

>GFF3822 Sensor histidine kinase ChvG (EC 2.7.3.-) (Sphingobium sp. HT1-2)
MAPDTASPKNEDAPLAVRWSGRLSLTPRILAVNVFALALLAGGFFYLDSYRTRIVDDRLE
QSARELKLLAIGLENAPADRQNALIAAYARQTGDRVRRYDAAGNLMADSFAMDAPRYRLR
LPSEEEWQRHVARFLDKAVDRVVSADRPPNFEEPAVDRASAWPELVLAAKTRQPQAMNRY
APDRTFMISAAVAVRDGSGLLATENARDITRIVRAERLRLGIVLAAAVLASVLLSLFLAR
TIVQPLQRLARAAVRVRLGRAREVTVPRLPERRDEIGMLARALSDMSHALRQRIDATDAF
AADVSHELKNPIASLRSALDSLERVDRPDLRDQLMAIAQDDVRRLDRLVTDIAEASRIDA
QLSRTRFEPIDLGLLIERMVLAREARGVPRGIRLAFARPRKEVAVVLGEEQRIVRVLDNL
IDNAISFSPDDGLVQIIATVADNEVLVSVEDEGPGVPEGEREHVFRRFHSVRPEGEAFGK
HSGLGLAIARSIVEGHQGKISIADREDRLSGARFIVRLPMAVERDPGIMSE