Protein Info for GFF3814 in Variovorax sp. SCN45

Annotation: OpgC protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 380 transmembrane" amino acids 7 to 25 (19 residues), see Phobius details amino acids 36 to 57 (22 residues), see Phobius details amino acids 77 to 101 (25 residues), see Phobius details amino acids 121 to 146 (26 residues), see Phobius details amino acids 158 to 181 (24 residues), see Phobius details amino acids 201 to 218 (18 residues), see Phobius details amino acids 230 to 248 (19 residues), see Phobius details amino acids 276 to 296 (21 residues), see Phobius details amino acids 309 to 332 (24 residues), see Phobius details amino acids 338 to 358 (21 residues), see Phobius details PF10129: OpgC_C" amino acids 3 to 361 (359 residues), 254.8 bits, see alignment E=1.2e-79 PF01757: Acyl_transf_3" amino acids 6 to 358 (353 residues), 38.6 bits, see alignment E=6.8e-14

Best Hits

KEGG orthology group: None (inferred from 92% identity to vpe:Varpa_1483)

Predicted SEED Role

"OpgC protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (380 amino acids)

>GFF3814 OpgC protein (Variovorax sp. SCN45)
MKRYWEIDALRGLMLVLMTVTHLPTRLTDPLGQPFGFVSAAEGFVLLSAFVAGLVYSRIG
FARGVDSMRQAFWRRVLKVYLCQAAILLFLFTVIAALGLHIDQPAVKNLVSYYLAEPREG
FIYGLLLIYEPALLDILPMYIFFMLMSPWVLAFAMRHGWSWVMAVSATVWAAAQFGLSEW
VYGLAVHYLGVPVPFHEMGAFNTYAWQFLWFAGLCIGATRNGPGAKPLKFPAWLLLLAAG
IALYGLYWRHHGINGQAPFGGDVELNLLFDKWQLGPLRLVNLVALGILAVRFGPWLMRRI
PRMHWLEAMGSASLPVFCAHLVAVLLVLAFYGDSQTARPWWGDGLLLLAVFSGMYLVARF
TRGADVPPPADDVPTEPARA