Protein Info for GFF3812 in Variovorax sp. SCN45

Annotation: Bis-ABC ATPase Uup

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 634 signal peptide" amino acids 1 to 15 (15 residues), see Phobius details PF00005: ABC_tran" amino acids 19 to 175 (157 residues), 90.8 bits, see alignment E=3e-29 amino acids 326 to 459 (134 residues), 86.7 bits, see alignment E=5.6e-28 PF12848: ABC_tran_Xtn" amino acids 214 to 286 (73 residues), 48.6 bits, see alignment E=1.7e-16 PF16326: ABC_tran_CTD" amino acids 561 to 630 (70 residues), 52.9 bits, see alignment E=8.5e-18

Best Hits

KEGG orthology group: None (inferred from 94% identity to vpe:Varpa_5428)

Predicted SEED Role

"COG0488: ATPase components of ABC transporters with duplicated ATPase domains" in subsystem Folate Biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (634 amino acids)

>GFF3812 Bis-ABC ATPase Uup (Variovorax sp. SCN45)
MALITLLDAQLAFGHVPLLDHADFSLQESERVGLIGRNGAGKSSLLKILGGLEKTDDGTL
QLQQNLRVAYVAQEPVLDMDADVFTAASQGLGPVIAIRDLYLSGADGLDLDALQSQIEAF
DAWNWEQRVEETLHRLHLDRDARVGSLSGGTRKRVALAQALVAAPDVLLLDEPTNHLDLD
SIEWLEQLLIDFKGSVVTVTHDRSFLNRVATRIVELDRGKLGSYPGNFEQYLVQKEEQLA
QEAVISAKADKLLAQEEIWIRKGVEARRTRSQSRITRLQELRASRSARREVQGSVNMDVA
SGQSSGKIVAELTEATKSFGPKTVIRNFSGTILRGDKVGLLGPNGAGKTTLLKLILGELE
PDSGKIRRGTNLQVAYFDQMRDKLDLDATLEDFISPGSEWIEIGSQKKHVKSYLSDFLFS
PARANSPVRSLSGGERNRLLLARLFARPANVLVLDEPTNDLDIDTLELLENLLQDYDGTV
FLVSHDRTFLDNVVTSTIAYEGDGRWREYEGSVQDWLIQSKRAREIAEQRQAAAPAPAPA
PAPAAAAEPAAPKAAAAPRKKLSYKEQRELEALPAQIESLEAEQKRITEMLELDGGAIYA
TDSSRATELAERHAKIDDELLSALERQEELGAGR