Protein Info for GFF3809 in Variovorax sp. SCN45

Annotation: Outer membrane receptor proteins, mostly Fe transport

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 768 signal peptide" amino acids 1 to 17 (17 residues), see Phobius details PF07715: Plug" amino acids 46 to 159 (114 residues), 44.5 bits, see alignment E=3.1e-15 PF00593: TonB_dep_Rec_b-barrel" amino acids 311 to 744 (434 residues), 158.2 bits, see alignment E=9.5e-50 PF14905: OMP_b-brl_3" amino acids 459 to 750 (292 residues), 37.5 bits, see alignment E=2.4e-13

Best Hits

KEGG orthology group: K02014, iron complex outermembrane recepter protein (inferred from 91% identity to vpe:Varpa_5431)

Predicted SEED Role

"Outer membrane receptor proteins, mostly Fe transport" in subsystem Hemin transport system

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (768 amino acids)

>GFF3809 Outer membrane receptor proteins, mostly Fe transport (Variovorax sp. SCN45)
MAFPFGATALAQQAPAADAPDTAGNNGRALSTVTVTGGRPTSLPAQIPTTIEGVTHDQIV
ETVNATDSEDALKYLPSLVVRKRYIGDFNHAVLATRASGTGNSARSMVYADGIMLSNPLG
NGATYAPRWGMVSPEEIERVDVLYGPFSAAYPGNSVGAVVDYVTRMPTQLEAHVKLSGFA
SNFDLYNSHSSPAGQQLDMSLGSRSGDWSWWLSASRTHNKGQALVFGNRLVSAGTVGSAG
TPVTGAVLGLNPSNQPWWLVGGSTIYDTTQEQAKLKVAYDFSPTVRATYTLGAWNNTTHG
SVDTYLRDPLGQPVYGGRVNIAGRTYNLDSPSAALAPTETALTHYMHGLSVKSHTGGVFD
WEVAASLFDYSSDTSRTPTTPLPGAFNGAAFGGQGRTTDMGGSGWNTFKAAGTWRPTGSA
EGVGAHVVDFGFQQDTARLRTSVGNTLDWINGSPVSPFSAFNGNTRLQSLYVQDTWRFAQ
DWKTTLGLRHERWEAYGGQLGNASTLLNFAPRKNSYDSPKAAVAWQATSDWLFKASTGRA
VRMPTVSELYQGSINGNQIVNTNPNLRPERSWTTELSAERDLKGWGLDGVLRTTLFFENT
KDALYTQALNNLVSTVQNVDAIRTRGLEVALNAVDVGVRGLDLSGSLTLTRSKITANSGF
PASVGHDQPRVPRVRAALLATYRPDANWSYTVGARYSGRQYGTLDGSDPNGFAYMGFSKF
FVVDARIRYRIDRQWSAAVGIDNLNNNRYWAFHPYPQRTYVAELKFDL