Protein Info for GFF3807 in Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868

Annotation: RND efflux system, outer membrane lipoprotein, NodT family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 478 signal peptide" amino acids 1 to 23 (23 residues), see Phobius details TIGR01845: efflux transporter, outer membrane factor (OMF) lipoprotein, NodT family" amino acids 17 to 475 (459 residues), 296 bits, see alignment E=2.5e-92 PF02321: OEP" amino acids 67 to 266 (200 residues), 64.2 bits, see alignment E=7e-22 amino acids 294 to 472 (179 residues), 44.7 bits, see alignment E=6.9e-16

Best Hits

Swiss-Prot: 82% identical to MDTQ_ECOL6: Multidrug resistance outer membrane protein MdtQ (mdtQ) from Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)

KEGG orthology group: None (inferred from 100% identity to seh:SeHA_C2406)

Predicted SEED Role

"RND efflux system, outer membrane lipoprotein, NodT family" in subsystem Multidrug Resistance Efflux Pumps

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (478 amino acids)

>GFF3807 RND efflux system, outer membrane lipoprotein, NodT family (Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868)
MNRNSFLAATASLPLFILLAGCAPMHDTRQSLTQQTPSSHVDSSLPAALKNGWPDSQWWK
AYHDAQLDALIDNAIQHSPDMQVAEQRIQLAEAQAKAVEAQDGPQLDFSADIERQRMSAE
GLMGPFAITDPAAGTTGPWYTNGTFGLTAGWDLDLWGKNRAEVTARIGAVKAREAEQEQT
RQLLASGVARLYWEWQTQAALKNVLMQIEHEQQNVVAVNRELYQHGITSSVEGVETDIDA
SKTQQQLNDVNGKMKVIEARLSALTNTQSAALKLRQVSLPAVESQLPSQLGYSLLARRAD
LQAAHWYIESSLSSIDAAKAAFYPDINLMAFLQQDALHLSDLFRHSAQQYGITGGLTLPI
FDSGRLNANLDIAKAQSNLSIANYNKAVVDAVNDVARAASQVETLAQKNQHQQQIEHDAQ
RVVGLAQARFNAGIIAGSRVSEAKIPALREQCNGLLLQGQWLDASIQLTSALGGGYHS