Protein Info for GFF3803 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: 4-carboxy-2-hydroxymuconate-6-semialdehyde dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 319 PF01408: GFO_IDH_MocA" amino acids 5 to 124 (120 residues), 79.3 bits, see alignment E=5.9e-26 PF19858: OxRdtase_C" amino acids 154 to 316 (163 residues), 309.9 bits, see alignment E=4.1e-97

Best Hits

Swiss-Prot: 75% identical to LIGC_SPHSK: 4-carboxy-2-hydroxymuconate-6-semialdehyde dehydrogenase (ligC) from Sphingobium sp. (strain NBRC 103272 / SYK-6)

KEGG orthology group: K10219, 2-hydroxy-4-carboxymuconate semialdehyde hemiacetal dehydrogenase [EC: 1.1.1.312] (inferred from 88% identity to pna:Pnap_2026)

MetaCyc: 85% identical to alpha-hydroxy-gamma-carboxymuconate epsilon-semialdehyde dehydrogenase subunit (Pseudomonas straminea)
1.2.1.45-RXN [EC: 1.1.1.312]

Predicted SEED Role

"4-carboxy-2-hydroxymuconate-6-semialdehyde dehydrogenase"

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.1.1.312

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (319 amino acids)

>GFF3803 4-carboxy-2-hydroxymuconate-6-semialdehyde dehydrogenase (Hydrogenophaga sp. GW460-11-11-14-LB1)
MTKTIKVALAGAGAFGIKHLDGIKNIDGVEVISLVGRELDKTKEVAAKYGIGHVTTELSE
SLALKELDAVILCTPTQMHAEQTLACLNAGKHVQVEIPLADSLAGAQAVVELQKKTGLVA
MCGHTRRFNPSHQYVHNQIQAGKFNIQQMDVQTYFFRRTNTNALGQARSWTDHLLWHHAA
HTVDLFAYQANSPIVQANAVQGPIHPALGIAMDMSIQLKAANGAICTLSLSFNNDGPLGT
YFRYIGDTATYIARYDDLFNGKEEQIDVSKVAVSMNGIELQDREFFAAIKEGREPNSSVG
RVFACYQVLHKLEQQLNAA