Protein Info for PS417_19455 in Pseudomonas simiae WCS417

Annotation: lipid A biosynthesis lauroyl acyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 311 transmembrane" amino acids 9 to 29 (21 residues), see Phobius details amino acids 33 to 51 (19 residues), see Phobius details amino acids 81 to 98 (18 residues), see Phobius details amino acids 125 to 143 (19 residues), see Phobius details PF03279: Lip_A_acyltrans" amino acids 4 to 296 (293 residues), 281.6 bits, see alignment E=3.7e-88 TIGR02207: lipid A biosynthesis lauroyl (or palmitoleoyl) acyltransferase" amino acids 4 to 306 (303 residues), 428 bits, see alignment E=1e-132

Best Hits

Swiss-Prot: 45% identical to LPXL_ECOLI: Lipid A biosynthesis lauroyltransferase (lpxL) from Escherichia coli (strain K12)

KEGG orthology group: K02517, lipid A biosynthesis lauroyl acyltransferase [EC: 2.3.1.-] (inferred from 97% identity to pfs:PFLU4368)

MetaCyc: 45% identical to lauroyl acyltransferase (Escherichia coli K-12 substr. MG1655)
LAUROYLACYLTRAN-RXN [EC: 2.3.1.241]

Predicted SEED Role

"Lipid A biosynthesis lauroyl acyltransferase (EC 2.3.1.-)" in subsystem KDO2-Lipid A biosynthesis (EC 2.3.1.-)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.3.1.-

Use Curated BLAST to search for 2.3.1.- or 2.3.1.241

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7UCR6 at UniProt or InterPro

Protein Sequence (311 amino acids)

>PS417_19455 lipid A biosynthesis lauroyl acyltransferase (Pseudomonas simiae WCS417)
MDRPRFRAVFLHPRFWLLWLGLGLLWLVTQLPYRALLTIGRLLGAGMYRVAGERRRIAAR
NLELCFPEKSAKERKQLLKENFASTGIAFFEMAMSWWWSRQRLARLAHVEGLEHLKQAQL
DGKGVILMALHFTTLEIGAALLGQKHTIDGMYREHGNPLFDYIQRRGRERHNLDSLAVER
EDVRGMLKLLRAGRAIWYAPDQDYGAKQSIFVPLFGIQAATVPATSKFAKLGKALVVPFT
QQRLADGSGYRLVIHPPLTDFPGESDEVDCLRINQWVEASVRECPEQYLWTHRRFKSRPP
GEPKLYEKRRR