Protein Info for PS417_19440 in Pseudomonas simiae WCS417

Annotation: purine permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 448 transmembrane" amino acids 20 to 45 (26 residues), see Phobius details amino acids 56 to 78 (23 residues), see Phobius details amino acids 85 to 104 (20 residues), see Phobius details amino acids 110 to 130 (21 residues), see Phobius details amino acids 138 to 161 (24 residues), see Phobius details amino acids 171 to 190 (20 residues), see Phobius details amino acids 197 to 220 (24 residues), see Phobius details amino acids 247 to 271 (25 residues), see Phobius details amino acids 325 to 346 (22 residues), see Phobius details amino acids 352 to 373 (22 residues), see Phobius details amino acids 385 to 404 (20 residues), see Phobius details amino acids 415 to 436 (22 residues), see Phobius details TIGR00801: uracil-xanthine permease" amino acids 17 to 431 (415 residues), 383 bits, see alignment E=1.9e-118 PF00860: Xan_ur_permease" amino acids 22 to 402 (381 residues), 349.3 bits, see alignment E=1.2e-108 TIGR03173: xanthine permease" amino acids 26 to 434 (409 residues), 520.2 bits, see alignment E=3.4e-160

Best Hits

Swiss-Prot: 51% identical to UACT_ECOLI: Uric acid transporter UacT (uacT) from Escherichia coli (strain K12)

KEGG orthology group: K03458, nucleobase:cation symporter-2, NCS2 family (inferred from 98% identity to pfs:PFLU4364)

MetaCyc: 51% identical to urate:H+ symporter (Escherichia coli K-12 substr. MG1655)
RXN-5076; TRANS-RXN0-530

Predicted SEED Role

"Xanthine permease" in subsystem Purine Utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7UF13 at UniProt or InterPro

Protein Sequence (448 amino acids)

>PS417_19440 purine permease (Pseudomonas simiae WCS417)
MTELAEPQIPAAPAMVRLPLLQLILVGLQHVLLMYGGAVAVPLIIGQAAGLSREEIAFLI
NADLLVAGIATMVQSFGIGPVGIRMPVMMGASFAAVGSMVAMAGMPGIGLQGIFGATIAA
GFFGMLIAPFMSKVVRFFPPLVTGTVITAIGLSLFPVAVNWAGGGSATATFGSPIYLAIA
ALVLATILLINRFMRGFWVNISVLIGMGLGYALCGALGMVDLSGLAMAPWVQVVTPLHFG
MPTFELAPILSMCLVVVIIFVESTGMFLALGKITGQDVTPKMLRRGLLCDAGASFFAGFF
NTFTHSSFAQNIGLVQMTGVRCRSVTLMAGVFLIVLSLLPKAAYLVASIPPAVLGGAAIA
MFGMVAATGIKILQEADIADRRNQLLVAVSIGMGLIPVVRPEFFAQLPLWMSPITHSGIA
MATLSALSLNILFNILGGAERPEVAPTH