Protein Info for GFF3797 in Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868

Annotation: Antiholin-like protein LrgA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 132 transmembrane" amino acids 12 to 32 (21 residues), see Phobius details amino acids 37 to 55 (19 residues), see Phobius details amino acids 67 to 86 (20 residues), see Phobius details amino acids 92 to 113 (22 residues), see Phobius details PF03788: LrgA" amino acids 23 to 113 (91 residues), 101.4 bits, see alignment E=1.1e-33

Best Hits

Swiss-Prot: 100% identical to YOHJ_SALSV: UPF0299 membrane protein YohJ (yohJ) from Salmonella schwarzengrund (strain CVM19633)

KEGG orthology group: K06518, holin-like protein (inferred from 100% identity to sec:SC2198)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (132 amino acids)

>GFF3797 Antiholin-like protein LrgA (Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868)
MSKSLNIIWQYIRAFVLIYACLYAGIFLASLLPITIPGSIIGMLILFVLLALQILPAKWV
NPGCYVLIRYMALLFVPIGVGVMQYFDLLRAQFGPVVVSCAISTLVVFVVVSWSSHLIHG
ERKVVGQKGTKK