Protein Info for GFF3795 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: Auxin Efflux Carrier

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 323 transmembrane" amino acids 6 to 26 (21 residues), see Phobius details amino acids 36 to 57 (22 residues), see Phobius details amino acids 64 to 84 (21 residues), see Phobius details amino acids 109 to 133 (25 residues), see Phobius details amino acids 135 to 149 (15 residues), see Phobius details amino acids 172 to 191 (20 residues), see Phobius details amino acids 201 to 223 (23 residues), see Phobius details amino acids 238 to 260 (23 residues), see Phobius details amino acids 266 to 284 (19 residues), see Phobius details amino acids 292 to 315 (24 residues), see Phobius details PF03547: Mem_trans" amino acids 10 to 310 (301 residues), 108.9 bits, see alignment E=1.1e-35

Best Hits

KEGG orthology group: K07088, (no description) (inferred from 52% identity to pna:Pnap_2164)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (323 amino acids)

>GFF3795 Auxin Efflux Carrier (Hydrogenophaga sp. GW460-11-11-14-LB1)
VLDILAITGPIYLCIALGFAAVRWRIFSAADMRVMGKFVIQFALPALLFNALASRPLAEL
LQPAYLLAFGAGSVVWLLISLWGARRLQKRSLTESAYTTMGMTCGNSTYIGYPVVLLAIG
PLAGVALAMNLLVENLIKLPFLMTLADVGASEKARSSWQHALHETLHRLVRNPMIVAIVL
GFVVALLGWPMPSVISRTVNLFGAASGGLALFIIGGTLVGLQVRGLRRQVAQITIGKLLL
HPAAVWATVMLLPLIGLPALTGELRAAVVLSAAMPMLGIYPLLAQRHGHEGFAAAALLAT
TVASFFTLSAILWLMRHSAGWLG