Protein Info for GFF3792 in Sphingobium sp. HT1-2

Annotation: Thiol:disulfide oxidoreductase TlpA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 208 signal peptide" amino acids 1 to 31 (31 residues), see Phobius details PF08534: Redoxin" amino acids 63 to 197 (135 residues), 58 bits, see alignment E=9.7e-20 PF00578: AhpC-TSA" amino acids 65 to 191 (127 residues), 51.3 bits, see alignment E=1.1e-17

Best Hits

KEGG orthology group: None (inferred from 70% identity to sjp:SJA_C1-28700)

Predicted SEED Role

"Thiol:disulfide oxidoreductase TlpA" in subsystem Biogenesis of c-type cytochromes

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (208 amino acids)

>GFF3792 Thiol:disulfide oxidoreductase TlpA (Sphingobium sp. HT1-2)
MISSLRSVMTLLLLAGLAACDRQSPPAGQANASASGEVTGDEVQPAAGGSAKGDFNYTID
RSKAGTPAPTFAFENPQGGTATLQDFAGRPLLVNLWATWCAPCVAEMPTLDALAAQSDSE
GDRGLAVLTISQDVQGQAAIKPFFAKHKLPHLKGWTDPENKLGLGYATGVLPTTVLYDAK
GKEVARVVGAMDWTGAEARKLIAMAKDE