Protein Info for GFF3791 in Xanthobacter sp. DMC5

Annotation: Acetyl-/propionyl-coenzyme A carboxylase alpha chain

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 666 PF00289: Biotin_carb_N" amino acids 5 to 113 (109 residues), 157.8 bits, see alignment E=5.1e-50 PF02786: CPSase_L_D2" amino acids 119 to 324 (206 residues), 262.5 bits, see alignment E=1.1e-81 PF02222: ATP-grasp" amino acids 126 to 294 (169 residues), 40.8 bits, see alignment E=7.9e-14 PF07478: Dala_Dala_lig_C" amino acids 142 to 293 (152 residues), 40.6 bits, see alignment E=8.3e-14 PF02785: Biotin_carb_C" amino acids 338 to 445 (108 residues), 119.3 bits, see alignment E=3.2e-38 PF21139: BT_MCC_alpha" amino acids 460 to 580 (121 residues), 54.1 bits, see alignment E=8.6e-18 PF00364: Biotin_lipoyl" amino acids 599 to 663 (65 residues), 59.3 bits, see alignment E=1.1e-19 PF25917: BSH_RND" amino acids 603 to 659 (57 residues), 28.1 bits, see alignment 6e-10

Best Hits

KEGG orthology group: K01968, 3-methylcrotonyl-CoA carboxylase alpha subunit [EC: 6.4.1.4] (inferred from 91% identity to xau:Xaut_1855)

Predicted SEED Role

"Methylcrotonyl-CoA carboxylase biotin-containing subunit (EC 6.4.1.4)" in subsystem HMG CoA Synthesis or Leucine Degradation and HMG-CoA Metabolism or Serine-glyoxylate cycle (EC 6.4.1.4)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 6.4.1.4

Use Curated BLAST to search for 6.4.1.4

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (666 amino acids)

>GFF3791 Acetyl-/propionyl-coenzyme A carboxylase alpha chain (Xanthobacter sp. DMC5)
MIRPIRTLLVANRGEIAVRVMRTAKALGLRTVAVYSQADADALHVAVADEAYPIGPAPAR
ESYLRIDAILDAAKKSGADAIHPGYGFLSENAAFADACEQAGIVFVGPPASAIRAMGSKS
AAKALMEKAGVPLVPGYHGEDQDAALLAREAQRIGFPVLIKASAGGGGKGMKVVRAAEDF
PEALASAQREAKSAFGDDKVLVEKYLTTPRHIEVQVFADSHGNCVYLHERDCSIQRRHQK
VVEEAPAPGMTPERRAAMGKAAVDAAKAVGYRGAGTVEFIAEGEHFYFMEMNTRLQVEHP
VTEAITGQDLVAWQIRVAQGETLPLTQEEIPLQGHAIEVRLYAEDPARDFLPQVGRLDHL
VLPSHLDHTRVDTGVRAGDTVSIHYDPMIAKIIVSGADRLEAVRRLEAALAATEVVGLAT
NRVFLKAIAAHPAFAAAELDTNFIARHQDVLLPAPAPVDDTVLALAALFVLKEEARQSAE
TVDAADPWSPWGLAPGWRLNRDAHVDLTFADRDERIAIRAHFRPHGFILALPGGDVAVEG
EAEADGSLRARLDGVALSARVIRTGNRLTVFVRGGEHAVDFIDPRLASQAATGTAGRLVA
PMPGTIIRIAVEEGQEVTKGAALVVVEAMKMEHTVAAPRDGKVKALKFAVGDLVDEGAEL
LVLEDA