Protein Info for GFF3790 in Variovorax sp. SCN45

Annotation: Formyltetrahydrofolate deformylase (EC 3.5.1.10)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 288 PF01842: ACT" amino acids 11 to 73 (63 residues), 35.9 bits, see alignment E=7.8e-13 TIGR00655: formyltetrahydrofolate deformylase" amino acids 12 to 287 (276 residues), 345.5 bits, see alignment E=1.4e-107 PF13740: ACT_6" amino acids 13 to 85 (73 residues), 27.2 bits, see alignment E=4.1e-10 PF00551: Formyl_trans_N" amino acids 92 to 269 (178 residues), 139.6 bits, see alignment E=1.5e-44

Best Hits

Swiss-Prot: 55% identical to PURU_CORS1: Formyltetrahydrofolate deformylase (purU) from Corynebacterium sp. (strain P-1)

KEGG orthology group: K01433, formyltetrahydrofolate deformylase [EC: 3.5.1.10] (inferred from 94% identity to vpe:Varpa_5450)

Predicted SEED Role

"Formyltetrahydrofolate deformylase (EC 3.5.1.10)" in subsystem One-carbon metabolism by tetrahydropterines (EC 3.5.1.10)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.5.1.10

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (288 amino acids)

>GFF3790 Formyltetrahydrofolate deformylase (EC 3.5.1.10) (Variovorax sp. SCN45)
MTTSTPTSPAYILNLSCPDRTGIVHAVSGFLLEHGANIEEAAQYNDHGTGLFFMRVRFAC
GDHSEAALREELKTFAAGFGMTLQLHAAAEPMKTVLLVSKEGHCLNDLLFRWKSGLLAID
VRAIISNHRDFYQLAASYNVPFHHIPVTAATKAQAEARQLEIIEAEGAELVVLARYMQIL
SNDLCRNLAGRAINIHHSFLPSFKGAKPYYQAHDRGVKLIGATAHYVTADLDEGPIIEQD
VARADHTDTVEDLTARGRDTESQVLARAVKWHSEHRVLLNGHRTVVFR