Protein Info for PS417_19400 in Pseudomonas simiae WCS417

Annotation: amino acid transporter LysE

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 211 transmembrane" amino acids 6 to 28 (23 residues), see Phobius details amino acids 40 to 65 (26 residues), see Phobius details amino acids 71 to 88 (18 residues), see Phobius details amino acids 120 to 141 (22 residues), see Phobius details amino acids 147 to 169 (23 residues), see Phobius details amino acids 188 to 208 (21 residues), see Phobius details PF01810: LysE" amino acids 14 to 206 (193 residues), 93.9 bits, see alignment E=4.6e-31

Best Hits

KEGG orthology group: None (inferred from 87% identity to pfo:Pfl01_1710)

Predicted SEED Role

"Homoserine/homoserine lactone efflux protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7UKZ1 at UniProt or InterPro

Protein Sequence (211 amino acids)

>PS417_19400 amino acid transporter LysE (Pseudomonas simiae WCS417)
MTLETWLLFSGAALIVILIPGPLSLLMISNSLNYGLRRSYPAFLGGVFASICLLSASALG
LGALLLASEQVFSALKIVGALYLFYLAWQSWQQSRQPSQGAVVPQAIATPRFRALFGRAF
VLGASNPKDILFFAAFLPQFLNREQPFLSQLLVMIATWAMLDLLCKLAYGLGAQGAARYL
RSGNGQSWFNRVSAGLFGGAGVMALIKVRTG