Protein Info for PS417_19395 in Pseudomonas simiae WCS417

Annotation: guanine permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 448 transmembrane" amino acids 38 to 56 (19 residues), see Phobius details amino acids 67 to 88 (22 residues), see Phobius details amino acids 94 to 138 (45 residues), see Phobius details amino acids 152 to 174 (23 residues), see Phobius details amino acids 186 to 206 (21 residues), see Phobius details amino acids 211 to 233 (23 residues), see Phobius details amino acids 253 to 272 (20 residues), see Phobius details amino acids 335 to 355 (21 residues), see Phobius details amino acids 361 to 382 (22 residues), see Phobius details amino acids 393 to 419 (27 residues), see Phobius details amino acids 430 to 447 (18 residues), see Phobius details PF00860: Xan_ur_permease" amino acids 37 to 409 (373 residues), 172.9 bits, see alignment E=4.4e-55

Best Hits

Swiss-Prot: 52% identical to ADEP_ECOLI: Adenine permease AdeP (adeP) from Escherichia coli (strain K12)

KEGG orthology group: K06901, putative MFS transporter, AGZA family, xanthine/uracil permease (inferred from 96% identity to pfs:PFLU4355)

MetaCyc: 52% identical to adenine:H+ symporter (Escherichia coli K-12 substr. MG1655)
TRANS-RXN0-447

Predicted SEED Role

"Xanthine/uracil/thiamine/ascorbate permease family protein" in subsystem Purine Utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7U6M0 at UniProt or InterPro

Protein Sequence (448 amino acids)

>PS417_19395 guanine permease (Pseudomonas simiae WCS417)
MDSRKSEAPTLDLAPSQNGWLERLFKLRLHGTTVRTELIAGLTTFITMAYIIFVNPNIMA
DAGIDHGAAFVATCIAAALGCLLMGLYANWPVGLAPGMGLNAFFTYTVVGTMGYTWETAL
GAVFISGVLFMGLTLSQVREWLLNSIPVSLRHAMGAGVGLFLGVIGLKTAGIIVESPATL
IKLGSLHEPAPLLAAVCFLLIAILSYHRVFGAILISIIAVTLAGWGLGLVHYNGMISTPP
SLAPTWMAMDIKGVFNVSMISVVFAFLFVHMFDTAGTLMGVAQRAGLVNADGKIDNLSRA
LKADSASSVFGAMVGVPPVTSYVESAAGVAAGGRTGLTAVTVGILFVAAMFFAPLAGMIP
AYATAGALIYVAMLMMASMAHINWDEATDSIPAIVTAIMMPLTFSVADGIALGFITYVAL
KAGTGKYRDISVSLWVLCAIFIAKFVFL