Protein Info for GFF3786 in Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868

Annotation: FIG00924762: possible membrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 380 transmembrane" amino acids 9 to 28 (20 residues), see Phobius details amino acids 48 to 72 (25 residues), see Phobius details amino acids 84 to 101 (18 residues), see Phobius details amino acids 107 to 123 (17 residues), see Phobius details amino acids 134 to 153 (20 residues), see Phobius details amino acids 195 to 216 (22 residues), see Phobius details amino acids 234 to 253 (20 residues), see Phobius details amino acids 274 to 292 (19 residues), see Phobius details amino acids 304 to 305 (2 residues), see Phobius details amino acids 307 to 327 (21 residues), see Phobius details amino acids 337 to 359 (23 residues), see Phobius details PF04235: DUF418" amino acids 215 to 374 (160 residues), 151.9 bits, see alignment E=8e-49

Best Hits

Swiss-Prot: 84% identical to YEIB_ECOLI: Uncharacterized protein YeiB (yeiB) from Escherichia coli (strain K12)

KEGG orthology group: K07148, uncharacterized protein (inferred from 99% identity to spt:SPA0659)

Predicted SEED Role

"FIG00924762: possible membrane protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (380 amino acids)

>GFF3786 FIG00924762: possible membrane protein (Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868)
MERNVTLDFVRGVAILGILLLNISAFGLPKAAYLNPAWYGAIVPEDAWSWAILDIVAQAK
FLTLFALLFGAGLQMLLPRGKQWIQSRLTLLVLLGFIHALFFWDGDILLAYGLVGLICWR
LIRDAPSVKSLFNTGILLYLVGIGVLLLLGVVSSSETSRAWTPDASAILYEKYWKLNGGM
EAISNRAEMLSNSLLALGAQYGWQLAGMMLLGAALMRSGWLKGQYSLRHYRRTGALLVAL
GLMINLPAVILQWRLDWAYRWCAFLLQAPRELSAPLQTLGYAALMFGFWPQLSRCRLTLA
IACVGRMALTNYLLQTIICTTLFYQFGLFMKFNRLELLFFVVPVWAINLLFSVIWLRFWR
QGPVEWLWRQLTLRASGSLR