Protein Info for PS417_19370 in Pseudomonas simiae WCS417

Annotation: citrate transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 430 signal peptide" amino acids 1 to 20 (20 residues), see Phobius details transmembrane" amino acids 29 to 50 (22 residues), see Phobius details amino acids 57 to 77 (21 residues), see Phobius details amino acids 99 to 126 (28 residues), see Phobius details amino acids 138 to 156 (19 residues), see Phobius details amino acids 176 to 194 (19 residues), see Phobius details amino acids 230 to 249 (20 residues), see Phobius details amino acids 254 to 271 (18 residues), see Phobius details amino acids 284 to 304 (21 residues), see Phobius details amino acids 325 to 342 (18 residues), see Phobius details amino acids 379 to 396 (18 residues), see Phobius details amino acids 409 to 429 (21 residues), see Phobius details TIGR00784: citrate transporter" amino acids 1 to 430 (430 residues), 413.7 bits, see alignment E=5.6e-128 PF03600: CitMHS" amino acids 15 to 376 (362 residues), 112.5 bits, see alignment E=2.4e-36 PF03553: Na_H_antiporter" amino acids 22 to 171 (150 residues), 24.6 bits, see alignment E=1.5e-09

Best Hits

KEGG orthology group: K03300, citrate-Mg2+:H+ or citrate-Ca2+:H+ symporter, CitMHS family (inferred from 99% identity to pfs:PFLU4350)

Predicted SEED Role

"Uncharacterized transporter, similarity to citrate transporter"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7U483 at UniProt or InterPro

Protein Sequence (430 amino acids)

>PS417_19370 citrate transporter (Pseudomonas simiae WCS417)
MLATLGVITILCLLAAVMSKRLSPLVALIALPIIAALLGGFGLQTSAFIITGIKNVAPVV
GMFVFAILFFGIMTDAGMLDPIIDRILRTVGTRPTRIVVGTATLALLVHLDGSGAVTFLV
TVPAMLPLYTRLGIDKRILACVCAMAAGVNFLPWTGPVLRSSAALHVPVADLFQPLIPVQ
IVGLIFVFVCAWWLGRREEKRLGLGAGSTVDAVPQRVLSDDDIKLRRPRLFWVNLILTVL
VMVVMIAGWVDPVVMFMLGTVVALCINYPNVDAQRARIDAHAKTALTMASILLAAGVFTG
IMQGTGMLKAIAEVAVAQIPAGHGKLIPAVVGFISMPLSMLFDPDSYYFGVMPVIAEVGK
ALGVDPLQVAQASLLGVHTTGFPVSPLTPATFLLVGLCKIELADHQRFTIPFLFAASVLM
TLTALLLGVI