Protein Info for GFF3778 in Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868

Annotation: Lysine-specific permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 489 transmembrane" amino acids 21 to 43 (23 residues), see Phobius details amino acids 52 to 73 (22 residues), see Phobius details amino acids 103 to 125 (23 residues), see Phobius details amino acids 131 to 149 (19 residues), see Phobius details amino acids 161 to 182 (22 residues), see Phobius details amino acids 201 to 224 (24 residues), see Phobius details amino acids 245 to 266 (22 residues), see Phobius details amino acids 287 to 312 (26 residues), see Phobius details amino acids 348 to 365 (18 residues), see Phobius details amino acids 371 to 394 (24 residues), see Phobius details amino acids 415 to 435 (21 residues), see Phobius details amino acids 447 to 467 (21 residues), see Phobius details PF00324: AA_permease" amino acids 21 to 477 (457 residues), 520.1 bits, see alignment E=5.2e-160 PF13520: AA_permease_2" amino acids 22 to 432 (411 residues), 137.9 bits, see alignment E=4.6e-44

Best Hits

Swiss-Prot: 94% identical to LYSP_ECOLI: Lysine-specific permease (lysP) from Escherichia coli (strain K12)

KEGG orthology group: K11733, lysine-specific permease (inferred from 100% identity to sty:STY2435)

MetaCyc: 94% identical to lysine:H+ symporter (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-58

Predicted SEED Role

"Lysine-specific permease" in subsystem YeiH

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (489 amino acids)

>GFF3778 Lysine-specific permease (Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868)
MGSKTKTTEAPALRRELKARHLTMIAIGGSIGTGLFVASGATISQAGPGGALFSYILIGL
MVYFLMTSLGELAAYMPVSGSFATYGQNYVEEGFGFALGWNYWYNWAVTIAVDLVAAQLV
MGWWFPDTPGWIWSALFLCVIFLLNYISVRGFGEAEYWFSLIKVATVIIFIIVGVAMIIG
IFKGVEPVGWSNWTTGDAPFAGGFAAMIGVAMIVGFSFQGTELIGIAAGESENPEKNIPR
AVRQVFWRILLFYVFAILIISLIIPYTDPNLLRNDVKDISVSPFTLVFQHAGLLSAAAIM
NAVILTAVLSAGNSGMYASTRMLYTLACDGKAPRIFAKLSRGGVPRNALYATTVIAGLCF
LTSMFGNQTVYLWLLNTSGMTGFIAWLGIAISHYRFRRGYVLQGYDVNDLPYRSGFFPLG
PIFAFVLCLIITLGQNYEAFLKDTIDWGGVAATYIGIPLFLLIWFGYKLIKGTHFVRYSE
MHFPERVKK