Protein Info for GFF377 in Variovorax sp. SCN45

Annotation: Carbamoyl-phosphate synthase small chain (EC 6.3.5.5)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01368: carbamoyl-phosphate synthase, small subunit
  • amino acids 12 to 390 (379 residues), 468.9 bits, E=5.1e-145
• PF00988: CPSase_sm_chain
  • amino acids 14 to 139 (126 residues), 177 bits, E=2.1e-56
• PF00117: GATase
  • amino acids 211 to 386 (176 residues), 177.9 bits, E=2.8e-56
• PF07722: Peptidase_C26
  • amino acids 265 to 301 (37 residues), 20.8 bits, 4.5e-08

Best Hits

Swiss-Prot: 76% identical to CARA_RUBGI: Carbamoyl-phosphate synthase small chain (carA) from Rubrivivax gelatinosus (strain NBRC 100245 / IL144)

KEGG orthology group: K01956, carbamoyl-phosphate synthase small subunit [EC: 6.3.5.5] (inferred from 96% identity to vpe:Varpa_3311)

Predicted SEED Role

"Carbamoyl-phosphate synthase small chain (EC 6.3.5.5)" in subsystem De Novo Pyrimidine Synthesis or Macromolecular synthesis operon (EC 6.3.5.5)

MetaCyc Pathways

• superpathway of histidine, purine, and pyrimidine biosynthesis (43/46 steps found)
• superpathway of pyrimidine deoxyribonucleotides de novo biosynthesis (17/18 steps found)
• L-arginine biosynthesis II (acetyl cycle) (10/10 steps found)
• superpathway of arginine and polyamine biosynthesis (15/17 steps found)
• L-arginine biosynthesis I (via L-ornithine) (9/9 steps found)
• L-glutamate and L-glutamine biosynthesis (7/7 steps found)
• UMP biosynthesis II (6/6 steps found)
• UMP biosynthesis III (6/6 steps found)
• L-arginine biosynthesis III (via N-acetyl-L-citrulline) (8/9 steps found)
• superpathway of pyrimidine ribonucleotides de novo biosynthesis (8/9 steps found)
• L-asparagine biosynthesis III (tRNA-dependent) (4/4 steps found)
• L-citrulline degradation (3/3 steps found)
• ammonia assimilation cycle III (3/3 steps found)
• UMP biosynthesis I (5/6 steps found)
• L-glutamate biosynthesis I (2/2 steps found)
• L-glutamine degradation I (1/1 steps found)
• L-citrulline biosynthesis (6/8 steps found)
• L-arginine degradation V (arginine deiminase pathway) (3/4 steps found)
• glutaminyl-tRNA^gln biosynthesis via transamidation (3/4 steps found)
• superpathway of L-citrulline metabolism (8/12 steps found)
• L-arginine biosynthesis IV (archaea) (4/9 steps found)
• allantoin degradation IV (anaerobic) (2/9 steps found)
• guadinomine B biosynthesis (2/13 steps found)

KEGG Metabolic Maps

• Glutamate metabolism
• Pyrimidine metabolism

Isozymes

Compare fitness of predicted isozymes for: 6.3.5.5

Use Curated BLAST to search for 6.3.5.5

Protein Sequence (399 amino acids)

>GFF377 Carbamoyl-phosphate synthase small chain (EC 6.3.5.5) (Variovorax sp. SCN45)
VLLSLKGSFPPAILALADGTVFQGNSIGAAGSTTGEVVFNTAMTGYQEILTDPSYCQQIV
TLTYPHIGNYGVNGEDIEADKIHAAGLIIKDLPLVASNFRKTATLTEYLVSGNTVAIANI
DTRKLTRHLRTHGAQNGCILGLAEGETVTQALIDKAIAAAKAAPSMAGLDLAKVVSVTQT
YEWTETEWKLVNLNGKPGYGVQITPKFHVVAFDYGVKKNILRMIAQRGARITVVPAQTPA
ADVLKLKPDGIFLANGPGDPEPCDYAISAVKELIETGIPTFGICLGHQIMALASGAKTFK
MKFGHHGANHPVKDLDNGRVSITSQNHGFAVDEKSLPANLRPTHVSLFDNTLQGLARTDK
PAFCFQGHPEASPGPHDIGYLFDRFTALMEKHKTENKNA