Protein Info for GFF3769 in Variovorax sp. SCN45

Annotation: FIG022979: MoxR-like ATPases

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 331 PF20030: bpMoxR" amino acids 16 to 187 (172 residues), 39.6 bits, see alignment E=1.1e-13 PF00158: Sigma54_activat" amino acids 40 to 160 (121 residues), 26.4 bits, see alignment E=1.8e-09 PF07726: AAA_3" amino acids 46 to 182 (137 residues), 203.1 bits, see alignment E=4.5e-64 PF07728: AAA_5" amino acids 46 to 180 (135 residues), 51.7 bits, see alignment E=3.5e-17 PF00004: AAA" amino acids 47 to 165 (119 residues), 31.2 bits, see alignment E=9.6e-11 PF17863: AAA_lid_2" amino acids 250 to 320 (71 residues), 62.4 bits, see alignment E=9.8e-21

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (331 amino acids)

>GFF3769 FIG022979: MoxR-like ATPases (Variovorax sp. SCN45)
MQAIQPEELTRAAQWLQTLRAEVGQAVVGQLEAVDQTLVALVASGHVLIEGVPGLGKTLL
ARALAQAMTLRYARVQFTPDLMPSDITGHAVLDIASRGEGSLGTLRVHQGPVFTNLLLAD
EINRAPAKTQSALLEVMQEYQVTLEGTAMPLPRPFMVMATQNPIDTEGTYPLPEAQLDRF
LLKIDIGFPSHSEENAIVQLTTNQRAGNQFPLDAVRPCLDEAQVLELQRLACLVQADERV
IDYAVRIARATRDWPGLSSGAGPRGTMALVRAARAAALMAGRDFITPDDVARQALPALRH
RVMISPDAQLEGVSVDALLRAARDSVEAPRL