Protein Info for PS417_19285 in Pseudomonas simiae WCS417

Annotation: ankyrin

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 171 PF12796: Ank_2" amino acids 23 to 109 (87 residues), 51.7 bits, see alignment E=2.7e-17 amino acids 89 to 166 (78 residues), 48.9 bits, see alignment E=2.1e-16 PF13637: Ank_4" amino acids 24 to 69 (46 residues), 29.2 bits, see alignment E=2.3e-10 amino acids 89 to 135 (47 residues), 44.8 bits, see alignment E=2.8e-15 amino acids 119 to 161 (43 residues), 24.3 bits, see alignment E=7.6e-09 PF13857: Ank_5" amino acids 35 to 86 (52 residues), 29.9 bits, see alignment E=1.4e-10 amino acids 101 to 152 (52 residues), 31.8 bits, see alignment E=3.7e-11 PF13606: Ank_3" amino acids 48 to 76 (29 residues), 22 bits, see alignment 3.9e-08 amino acids 114 to 141 (28 residues), 26 bits, see alignment 1.9e-09 PF00023: Ank" amino acids 48 to 79 (32 residues), 29.8 bits, see alignment 1.3e-10 amino acids 89 to 111 (23 residues), 15.5 bits, see alignment (E = 4.4e-06) amino acids 114 to 145 (32 residues), 28 bits, see alignment 4.7e-10

Best Hits

Swiss-Prot: 53% identical to Y3287_PSEAE: Putative ankyrin repeat protein PA3287 (PA3287) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K06867, (no description) (inferred from 94% identity to pfs:PFLU4331)

Predicted SEED Role

"FOG: Ankyrin repeat"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7TZJ2 at UniProt or InterPro

Protein Sequence (171 amino acids)

>PS417_19285 ankyrin (Pseudomonas simiae WCS417)
MSDQAKQMTDDEAAEFAEQVFDVARKGDAAMLAALLAKGLPANFRNHNGDTLLMLAAYHG
HADAVKVLLEFKADPLIANDKNQLPIAGAAFKGNLEVVKALIEGGAPVDASSSDGRTALM
MAAMFNRVEMLDYLLGQDADPKATDAQGATALAAAHTMGAVDTAAKLQKLV