Protein Info for GFF3762 in Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868

Annotation: Putative membrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 248 transmembrane" amino acids 16 to 35 (20 residues), see Phobius details amino acids 73 to 91 (19 residues), see Phobius details amino acids 103 to 124 (22 residues), see Phobius details amino acids 165 to 193 (29 residues), see Phobius details amino acids 202 to 222 (21 residues), see Phobius details PF01569: PAP2" amino acids 126 to 225 (100 residues), 35.9 bits, see alignment E=2.9e-13

Best Hits

Swiss-Prot: 84% identical to LPXT_ECOLI: Lipid A 1-diphosphate synthase (lpxT) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 99% identity to sei:SPC_1487)

MetaCyc: 84% identical to lipid A-core phosphotransferase (Escherichia coli K-12 substr. MG1655)
Undecaprenyl-diphosphatase. [EC: 3.6.1.27]; RXN-16281 [EC: 3.6.1.27, 2.7.4.29]; 2.7.4.29 [EC: 3.6.1.27, 2.7.4.29]

Predicted SEED Role

"Putative membrane protein"

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.6.1.27

Use Curated BLAST to search for 2.7.4.29 or 3.6.1.27

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (248 amino acids)

>GFF3762 Putative membrane protein (Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868)
LPPFKNYGEMTMKTRYSLIILLNAAGLALFLSWYLPVNHGFWFTIDSGIFHFFNQKLVES
HAFLWWVAITNNRAFDGCSLLAMGGLMLSFWLKENASGRRRIVIIGLVMLLTAVVLNQLG
QALIPVKRASPTLSFEHIYRVSELLHIPTKDASKDSFPGDHGMMLLIFSAFMLRYFGKTA
GIIALIIFVVFAFPRVMIGAHWFTDIVVGSLTVILIGLPWWLMTPLSDRAIALFENYLPG
GNKQILNK