Protein Info for PS417_01915 in Pseudomonas simiae WCS417

Annotation: ATP-dependent protease ATP-binding subunit HslU

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 445 TIGR00390: ATP-dependent protease HslVU, ATPase subunit" amino acids 3 to 445 (443 residues), 700.3 bits, see alignment E=5.6e-215 PF07728: AAA_5" amino acids 51 to 87 (37 residues), 24.4 bits, see alignment 7.6e-09 PF00004: AAA" amino acids 52 to 136 (85 residues), 33.4 bits, see alignment E=1.8e-11 amino acids 239 to 330 (92 residues), 28.8 bits, see alignment E=4.4e-10 PF07724: AAA_2" amino acids 171 to 327 (157 residues), 95.1 bits, see alignment E=1.5e-30

Best Hits

Swiss-Prot: 100% identical to HSLU_PSEFS: ATP-dependent protease ATPase subunit HslU (hslU) from Pseudomonas fluorescens (strain SBW25)

KEGG orthology group: K03667, ATP-dependent HslUV protease ATP-binding subunit HslU (inferred from 100% identity to pfs:PFLU0398)

MetaCyc: 72% identical to ATPase component of the HslVU protease (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"ATP-dependent hsl protease ATP-binding subunit HslU" in subsystem Proteasome bacterial or Proteolysis in bacteria, ATP-dependent

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7UES1 at UniProt or InterPro

Protein Sequence (445 amino acids)

>PS417_01915 ATP-dependent protease ATP-binding subunit HslU (Pseudomonas simiae WCS417)
MSMTPREIVHELNRHIIGQDDAKRAVAIALRNRWRRMQLPEELRVEVTPKNILMIGPTGV
GKTEIARRLAKLANAPFIKVEATKFTEVGYVGRDVESIIRDLADAALKLLREQEMTKVSH
RAEDAAEERILDALLPPARMGFNEDAAPASDSNTRQLFRKRLREGQLDDKEIEIEVAEVS
GVDISAPPGMEEMTSQLQNLFANMGKGKKKSRKLKVKEALKLVRDEEAGRLVNEEELKAK
ALEAVEQHGIVFIDEIDKVAKRGNSGGVDVSREGVQRDLLPLIEGCTVNTKLGMVKTDHI
LFIASGAFHLSKPSDLVPELQGRLPIRVELKALTPGDFERILSEPHASLTEQYRELLKTE
GLGIEFQADGIKRLAEIAWQVNEKTENIGARRLHTLLERLLEEVSFSAGDLAGAQNGEVI
KIDAEYVNSHLGELAQNEDLSRYIL