Protein Info for GFF3759 in Variovorax sp. SCN45

Annotation: Uridine kinase family protein YggC homolog

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

No protein families (PFam or TIGRFam), signal peptides, or transmembrane helices were found in this protein.

Best Hits

KEGG orthology group: None (inferred from 88% identity to vpe:Varpa_5469)

Predicted SEED Role

"Pantothenate kinase (EC 2.7.1.33)" in subsystem Coenzyme A Biosynthesis (EC 2.7.1.33)

MetaCyc Pathways

• superpathway of coenzyme A biosynthesis II (plants) (9/10 steps found)
• superpathway of coenzyme A biosynthesis I (bacteria) (8/9 steps found)
• superpathway of coenzyme A biosynthesis III (mammals) (5/5 steps found)
• phosphopantothenate biosynthesis I (4/4 steps found)
• phosphopantothenate biosynthesis II (1/3 steps found)

KEGG Metabolic Maps

• Pantothenate and CoA biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 2.7.1.33

Use Curated BLAST to search for 2.7.1.33

Protein Sequence (217 amino acids)

>GFF3759 Uridine kinase family protein YggC homolog (Variovorax sp. SCN45)
MSTTPAQKLPPLPADSAARLQALMSSGQRKLLGLVGAPGAGKSTLAAALLALAGADRAQV
VPMDGFHLANVELQRLGRADRKGAPDTFDSAGYVALLQRLREQRPDSDIVYAPEFRREIE
EPVAGAIAVLPTTQLVITEGNYLLHDAGPWAGAAAMLDEVWYVDIDDALREERLVRRHQQ
FGRSAEEARAWVASTDAPNARLIAATRVRAHHVLPWA