Protein Info for GFF3757 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: Inner membrane component of tripartite multidrug resistance system

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 509 signal peptide" amino acids 1 to 32 (32 residues), see Phobius details transmembrane" amino acids 49 to 70 (22 residues), see Phobius details amino acids 79 to 102 (24 residues), see Phobius details amino acids 104 to 106 (3 residues), see Phobius details amino acids 108 to 127 (20 residues), see Phobius details amino acids 138 to 159 (22 residues), see Phobius details amino acids 165 to 187 (23 residues), see Phobius details amino acids 199 to 218 (20 residues), see Phobius details amino acids 227 to 249 (23 residues), see Phobius details amino acids 269 to 292 (24 residues), see Phobius details amino acids 300 to 322 (23 residues), see Phobius details amino acids 334 to 352 (19 residues), see Phobius details amino acids 358 to 383 (26 residues), see Phobius details amino acids 470 to 494 (25 residues), see Phobius details TIGR00711: drug resistance MFS transporter, drug:H+ antiporter-2 (14 Spanner) (DHA2) family" amino acids 13 to 494 (482 residues), 508 bits, see alignment E=1.3e-156 PF07690: MFS_1" amino acids 17 to 410 (394 residues), 182.7 bits, see alignment E=9.5e-58 PF06609: TRI12" amino acids 20 to 289 (270 residues), 27.8 bits, see alignment E=9.3e-11

Best Hits

Swiss-Prot: 52% identical to EMRB_ECO57: Multidrug export protein EmrB (emrB) from Escherichia coli O157:H7

KEGG orthology group: K03446, MFS transporter, DHA2 family, multidrug resistance protein B (inferred from 69% identity to dac:Daci_3742)

MetaCyc: 52% identical to multidrug efflux pump membrane subunit EmrB (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-363; TRANS-RXN-364; TRANS-RXN-365

Predicted SEED Role

"Inner membrane component of tripartite multidrug resistance system" in subsystem Multidrug Resistance, Tripartite Systems Found in Gram Negative Bacteria

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (509 amino acids)

>GFF3757 Inner membrane component of tripartite multidrug resistance system (Hydrogenophaga sp. GW460-11-11-14-LB1)
VFEPLKGAQLVLGTLALSLATFMNVLDTSIANVSIPAIAGDMGVSPAQGTWVITSFAVAN
AISVPLTGWLTQRFGQVRLFTMSVLLFVVASWLCGLAPNIGLLIAFRVLQGLVAGPMIPL
SQTLLLASYPRAKAGTAMAMWAMTVLVAPVAGPLLGGWITDNISWPWIFYINIPVGLVAA
ALTWSIYRSRDPGPRRVPLDVIGLVLLVLFVGAMQIMIDMGKELDWFASGEIIALAVVAV
VSFLFFLAWELTDKHPIVEIRLFARRNFVTGTLALSVAYGLFFGNVVLLPLWLQQHMGYT
ATWAGLATAPVGLLAIVLSPWVGKNVSRIDPRKLATVAFIGFGLVLWMRSHFNTQADFMT
ILIPTLLQGAAMAFFFIPLQAIVFSGLQPQQTPSAAGLSNFVRITAGAVGTSLFTTLWDS
RASLHHAQLVESIHTGNATAMATLDQLMGSGLSREQALANIDRMINQQAYTLAVTDLFYL
SAALFFVLVAVIWFSKPVLGAAVDAGGAH