Protein Info for GFF3756 in Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868

Annotation: Putative ABC transporter ATP-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 529 PF00005: ABC_tran" amino acids 26 to 185 (160 residues), 100.3 bits, see alignment E=3.5e-32 amino acids 302 to 454 (153 residues), 112.3 bits, see alignment E=6.9e-36 PF08352: oligo_HPY" amino acids 236 to 265 (30 residues), 23.5 bits, see alignment (E = 1.5e-08)

Best Hits

Swiss-Prot: 87% identical to YEJF_ECOLI: Uncharacterized ABC transporter ATP-binding protein YejF (yejF) from Escherichia coli (strain K12)

KEGG orthology group: K13896, microcin C transport system ATP-binding protein (inferred from 99% identity to sei:SPC_1481)

MetaCyc: 87% identical to putative oligopeptide ABC transporter ATP binding subunit YejF (Escherichia coli K-12 substr. MG1655)
3.6.3.23-RXN [EC: 7.4.2.6]

Predicted SEED Role

"Putative ABC transporter ATP-binding protein"

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.4.2.6

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (529 amino acids)

>GFF3756 Putative ABC transporter ATP-binding protein (Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868)
MTSPLLAIENLSVGFRQQQHVRPVVNAISLQVNAGETLALVGESGSGKSVTALSILRLLP
TPPAVYLSGDIRFHGESLLHASEQTLRGVRGNKIAMIFQEPMVSLNPLHTLEKQLYEVLS
LHRGMSREAARAEMIGCLDRVGIRQASQRLRDYPHQLSGGERQRVMIAMALLTRPELLIA
DEPTTALDVSVQAQILSLLRELQRELNMGLLFITHNLSIVKKLADSVAVMQHGKCVENQR
ADTLLSAPTHPYTQKLLNSEPTGDPVPLPAGQAPLLEVDKLRVAFPIRKGILKRVVDHNV
VVNNISFTLHPGETLGLVGESGSGKSTTGLALLRLIRSEGRIVFDGQSLDTLNRRQLLPV
RHRIQVVFQDPNSSLNPRLNVLQIIEEGLRVHQPTLSGAQREQQVKAVMMEVGLDPETRH
RYPAEFSGGQRQRIAVARALILKPSLIILDEPTSSLDKTVQAQILALLKSLQQKHRLAYI
FISHDLHVVRALCHQVIVLRQGEVVEQGQCERVFTAPQQAYTRQLLALS