Protein Info for GFF3750 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: ABC-type nitrate/sulfonate/bicarbonate transport system, permease component

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 261 transmembrane" amino acids 12 to 29 (18 residues), see Phobius details amino acids 63 to 88 (26 residues), see Phobius details amino acids 100 to 122 (23 residues), see Phobius details amino acids 128 to 147 (20 residues), see Phobius details amino acids 188 to 212 (25 residues), see Phobius details amino acids 222 to 243 (22 residues), see Phobius details signal peptide" amino acids 30 to 33 (4 residues), see Phobius details PF00528: BPD_transp_1" amino acids 76 to 249 (174 residues), 95.7 bits, see alignment E=1.5e-31

Best Hits

KEGG orthology group: K02050, sulfonate/nitrate/taurine transport system permease protein (inferred from 70% identity to pae:PA3512)

Predicted SEED Role

"ABC-type nitrate/sulfonate/bicarbonate transport system, permease component" in subsystem Alkanesulfonate assimilation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (261 amino acids)

>GFF3750 ABC-type nitrate/sulfonate/bicarbonate transport system, permease component (Hydrogenophaga sp. GW460-11-11-14-LB1)
MKDLLQRYSTALWSLLVLVLFMGTWEYLPGVLGVPEFVLPPFSRVWEEAVRIWGSERLLW
HAGITGAEVVIGFILGSLLGALIGYALGLSPKVEAVLSPYLLALQIAPKVAFAPLFVMWL
GYTMYPKILVAVLIVFFPVLINVLSAMRTMDHDLINLARSFSATRLQVFRMVEFPTTLPP
LFSGLRIASTLAVIGVVVGELVGGNMGLGYMLVFFEGQGNTAGVFVVIAALTVIGIIAYY
AVVIAEKRVLHYLPSAERRVA