Protein Info for PS417_19190 in Pseudomonas simiae WCS417

Annotation: BolA family transcriptional regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 25 50 75 97 PF01722: BolA" amino acids 12 to 80 (69 residues), 83.8 bits, see alignment E=4.3e-28

Best Hits

Swiss-Prot: 44% identical to BOLA_HAEIN: DNA-binding transcriptional regulator BolA (bolA) from Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)

KEGG orthology group: K05527, BolA protein (inferred from 95% identity to pfs:PFLU4312)

Predicted SEED Role

"Cell division protein BolA" in subsystem Bacterial Cell Division

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7UKV8 at UniProt or InterPro

Protein Sequence (97 amino acids)

>PS417_19190 BolA family transcriptional regulator (Pseudomonas simiae WCS417)
MTMQQRIETALAALGPNHLSVLDESHMHSRGLQTHFKAVLVSQQFDGLNRVKRHQKVYAT
LGDLMSEFHALALHTYTPEEWAKIDAAPASPTCAGGH