Protein Info for GFF3748 in Variovorax sp. SCN45

Annotation: no description

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00701: DHDPS
  • amino acids 1 to 280 (280 residues), 240.3 bits, E=9.6e-76
• TIGR00674: 4-hydroxy-tetrahydrodipicolinate synthase
  • amino acids 1 to 280 (280 residues), 222.6 bits, E=2.4e-70

Best Hits

Swiss-Prot: 38% identical to DAPA_METKA: 4-hydroxy-tetrahydrodipicolinate synthase (dapA) from Methanopyrus kandleri (strain AV19 / DSM 6324 / JCM 9639 / NBRC 100938)

KEGG orthology group: K01714, dihydrodipicolinate synthase [EC: 4.2.1.52] (inferred from 41% identity to tmr:Tmar_1036)

Predicted SEED Role

No annotation

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from ornithine, lysine and nicotinic acid
• Lysine biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 4.2.1.52

Use Curated BLAST to search for 4.2.1.52

Protein Sequence (285 amino acids)

>GFF3748 no description (Variovorax sp. SCN45)
MATPFTADHRLDEGRVGELIESYIKAGVHGISVAGSQGEFFALERDEHIRLLELSMRAID
GRVPLYAGTGGATTRDAIALTQAAEAMGADLALVITPYFVQPTQDELVAHYTAVARATKL
PVMLYNNPPRTSVNVLPATLARCMRAADNIVGMKDSGGDLTQSIEYLLTAPRPALLFSGR
DTIALSMMFHGAQGTISPAANVFPELMVRMYDALRAGNHEEALRLSNVFAPLRAAWAWGS
FPVVIKEAMTLAGRGAGPTRPPVAALPEKLRADLEAVVKRIAATA