Protein Info for GFF3747 in Xanthobacter sp. DMC5

Annotation: Recombination protein RecR

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 201 TIGR00615: recombination protein RecR" amino acids 8 to 198 (191 residues), 206.2 bits, see alignment E=1.8e-65 PF21176: RecR_HhH" amino acids 10 to 53 (44 residues), 47 bits, see alignment 4.6e-16 PF13662: Toprim_4" amino acids 84 to 174 (91 residues), 78.2 bits, see alignment E=1.1e-25 PF21175: RecR_C" amino acids 176 to 199 (24 residues), 41.6 bits, see alignment (E = 1.6e-14)

Best Hits

Swiss-Prot: 88% identical to RECR_XANP2: Recombination protein RecR (recR) from Xanthobacter autotrophicus (strain ATCC BAA-1158 / Py2)

KEGG orthology group: K06187, recombination protein RecR (inferred from 88% identity to xau:Xaut_1839)

MetaCyc: 38% identical to recombination mediator protein RecR (Escherichia coli K-12 substr. MG1655)
RXN0-2606

Predicted SEED Role

"Recombination protein RecR" in subsystem DNA-replication or DNA repair, bacterial RecFOR pathway

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (201 amino acids)

>GFF3747 Recombination protein RecR (Xanthobacter sp. DMC5)
MPRAVAGPEIERLIQLLARLPGLGPRSARRVALHLIKKREALMAPLATALGDAIGKIVTC
RTCGNVDVTDPCTVCTDPTRDARTLVVVADVGDLWALERAGVLNARYHVLGGVLSPLDGV
GPDDLNIASLVTRVHDQEVSEVILALGATVDGQTTAHYLTDVLRDTGARVTRLAQGVPVG
GELDYLDEGTLSAAIRARTQM