Protein Info for GFF3747 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: Alpha/beta hydrolase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 259 PF00561: Abhydrolase_1" amino acids 22 to 229 (208 residues), 69.2 bits, see alignment E=1.2e-22 PF12697: Abhydrolase_6" amino acids 22 to 254 (233 residues), 80.7 bits, see alignment E=6.4e-26 PF12146: Hydrolase_4" amino acids 22 to 232 (211 residues), 70.9 bits, see alignment E=2.7e-23 PF06259: Abhydrolase_8" amino acids 40 to 119 (80 residues), 26.9 bits, see alignment E=8.9e-10 PF06821: Ser_hydrolase" amino acids 65 to 124 (60 residues), 22.3 bits, see alignment E=2.7e-08

Best Hits

KEGG orthology group: K01055, 3-oxoadipate enol-lactonase [EC: 3.1.1.24] (inferred from 53% identity to bpm:BURPS1710b_A2497)

Predicted SEED Role

No annotation

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.1.1.24

Use Curated BLAST to search for 3.1.1.24

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (259 amino acids)

>GFF3747 Alpha/beta hydrolase (Hydrogenophaga sp. GW460-11-11-14-LB1)
VLADGARLSYREAGSAKDVTHVLLHGIGSASGSWVRQLDAAAGQPVRVLAWDAPGYGTSD
PVKADWPRADDYAERLWAWLDALGVQTPITLVGHSLGALMAGRAALLAPARVQRLVLLSP
AGGYGNAEPAVREQKLRDRLASLERLGPQGMAQARGTAMLSPGAAPELVEAVRESMSQVI
PAGYTQAARLLAHGTLAADLKQLRLPVAVASGGADGITTPSSCQAVAQAAGVSWNDLGSA
GHACPLEAPGAVNALLGLN