Protein Info for GFF3744 in Xanthobacter sp. DMC5

Annotation: Chromosome partitioning protein ParA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 284 PF13614: AAA_31" amino acids 20 to 200 (181 residues), 188.5 bits, see alignment E=3.7e-59 PF10609: ParA" amino acids 20 to 169 (150 residues), 34.9 bits, see alignment E=4.1e-12 PF09140: MipZ" amino acids 21 to 185 (165 residues), 41.8 bits, see alignment E=3e-14 PF06564: CBP_BcsQ" amino acids 21 to 268 (248 residues), 36 bits, see alignment E=1.9e-12 PF01656: CbiA" amino acids 23 to 251 (229 residues), 107.1 bits, see alignment E=2.1e-34 PF02374: ArsA_ATPase" amino acids 28 to 63 (36 residues), 25.7 bits, see alignment 2.3e-09

Best Hits

Swiss-Prot: 66% identical to PARA_CAUVN: Chromosome partitioning protein ParA (parA) from Caulobacter vibrioides (strain NA1000 / CB15N)

KEGG orthology group: K03496, chromosome partitioning protein (inferred from 92% identity to xau:Xaut_1836)

Predicted SEED Role

"Chromosome (plasmid) partitioning protein ParA" in subsystem Bacterial Cytoskeleton or Plasmid replication or Two cell division clusters relating to chromosome partitioning

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (284 amino acids)

>GFF3744 Chromosome partitioning protein ParA (Xanthobacter sp. DMC5)
MSQADYSSGADLSLPAGAPRVLALANQKGGVGKTTTAINLGTALAAIGETVLVVDLDPQG
NASTGLGIDRRSRNVSTYDVLVGEATMRETVMPTGVPQLYVAPSTLDLSGLELEIAAERD
RAYRLRDALRALAADPEAPRFSYVLVDCPPSLSLLTVNAMAAADAIVVPLQCEFFALEGL
SQLMKTVEQVRVGLNPSLTIHGIVLTMYDGRNNLSEQVVQDVRQFMGDKVYETIIPRNVR
VSEAPSYGKPVLLYDLKCLGSQAYLRLASEVIQRERAARAAAAA