Protein Info for GFF3744 in Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868

Annotation: O-antigen acetylase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 609 transmembrane" amino acids 12 to 28 (17 residues), see Phobius details amino acids 34 to 54 (21 residues), see Phobius details amino acids 69 to 92 (24 residues), see Phobius details amino acids 132 to 155 (24 residues), see Phobius details amino acids 162 to 182 (21 residues), see Phobius details amino acids 188 to 209 (22 residues), see Phobius details amino acids 220 to 237 (18 residues), see Phobius details amino acids 243 to 260 (18 residues), see Phobius details amino acids 272 to 292 (21 residues), see Phobius details amino acids 303 to 322 (20 residues), see Phobius details amino acids 336 to 354 (19 residues), see Phobius details PF01757: Acyl_transf_3" amino acids 9 to 319 (311 residues), 135.1 bits, see alignment E=3.1e-43 PF19040: SGNH" amino acids 394 to 603 (210 residues), 103.5 bits, see alignment E=1.6e-33

Best Hits

KEGG orthology group: None (inferred from 100% identity to spq:SPAB_00767)

Predicted SEED Role

"O-antigen acetylase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (609 amino acids)

>GFF3744 O-antigen acetylase (Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868)
MIYKKFRLDINGLRAFALISVVLYHFGVPYVSGGFIGVDVFFVISGFLMTGIVLERVDHK
GVLDFYIARFLRIVPALVFAILLLMIFGLFTLSTNEYEALSKNAISSLLFYSNNYYAIHS
SYFDSSSEFNFLLHTWSLSVEWQFYILYPLLVIIVKKLRFPVGLSLSVILAMSLAITLMR
VTGTKEDIFYLIPTRAWEMLAGGLVYIASVRYKMPEWIKHCEVYGIVLIVVAVVILHSNG
YWPSYSALAPVLGASMVILANKQNSLFTSNRIAQWVGKISYSVYLWHWPVIVAMKHYDIE
FSAINIFFGVIVSFALGDISYRTIENTLRKRVKLQFNIVLFSSTLALCLFVMFTKGVSFR
FSDTLKQVVEYRMDNSPWRPDICFLNPDQDYSAFSKCQDKMTEKSFVVWGDSHAAHLMPG
LKSVFGNSLNITQRTASLCPPIIGLQKDDRPYCKDINDMVAKEISDNKPTTVLMSALWPV
YPMRDYLPETIKFLKDNKVKNIIIVGPFPVWKKTMIDTIEDMGINSGRTVPWSMTDETRN
LRDNDKYLRELAKEHSLTYISPLETMCTESYCKAIIGNRIAYPIQYDNAHLTPEGSGWFI
EEVKKQISK