Protein Info for PS417_19150 in Pseudomonas simiae WCS417

Annotation: ABC transporter ATP-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 transmembrane" amino acids 27 to 48 (22 residues), see Phobius details amino acids 79 to 102 (24 residues), see Phobius details amino acids 161 to 180 (20 residues), see Phobius details amino acids 186 to 204 (19 residues), see Phobius details amino acids 287 to 312 (26 residues), see Phobius details PF00664: ABC_membrane" amino acids 64 to 316 (253 residues), 104.6 bits, see alignment E=7.6e-34 PF00005: ABC_tran" amino acids 378 to 526 (149 residues), 109.8 bits, see alignment E=1.6e-35

Best Hits

KEGG orthology group: K06148, ATP-binding cassette, subfamily C, bacterial (inferred from 98% identity to pfs:PFLU4309)

Predicted SEED Role

"Lipid A export ATP-binding/permease protein MsbA" in subsystem ZZ gjo need homes

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7U1N3 at UniProt or InterPro

Protein Sequence (600 amino acids)

>PS417_19150 ABC transporter ATP-binding protein (Pseudomonas simiae WCS417)
MHEPAQRTDRLTWAEIRRLALRHKKSLWIANGVAVLATLCSVPIPLLLPLLVDEVLLGHG
DAALNVMNHALPLGWQKAAGYIGLMLLVTLFLRCGALVFNVVQARLFARLAKDIVYRIRV
RLIERLKRISLGEYESLGSGTVTTHLVTDLDTLDKFVGETLSRFLVAMLTLVGTSAILVW
MHWQLALLILLFNPLVIYATVQLGKRVKHLKKLENDSTSRFTQALTETLDAIQEVRAGNR
QGFFLGRLGQRAREVRDYAIHSQWKTDASSRASGLLFQFGIDIFRAAAMLTVLFSDLSIG
QMLAVFSYLWFMIGPVEQLLNLQYAYYAAGGALTRINELLARADEPQYAGGEDPFVGRET
VGIEVRGLNFGYGEDLVLDQLNLAIAPGEKVAIVGASGGGKSTLVQLLLGLYTPQAGTIR
FGGATQQEIGLETIRENVAVVLQHPALFNDTVRANLTMGRERSDQACWQALEIAQLDATV
KSLPLGLDSVVGRSGVRFSGGQRQRLAIARMVLAEPKVVILDEATSALDAATEYNLHQAL
ARFLSGRTTLIIAHRLSAVKQADRVLVFDGGHIAEDGDHQQLIADGGLYAKLYGHLQQVR