Protein Info for GFF3741 in Hydrogenophaga sp. GW460-11-11-14-LB1
Annotation: Aldehyde dehydrogenase (EC 1.2.1.3)
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Predicted SEED Role
"Aldehyde dehydrogenase (EC 1.2.1.3)" in subsystem Entner-Doudoroff Pathway or Glycerolipid and Glycerophospholipid Metabolism in Bacteria or Methylglyoxal Metabolism or Pyruvate metabolism II: acetyl-CoA, acetogenesis from pyruvate (EC 1.2.1.3)
MetaCyc Pathways
- phytol degradation (4/4 steps found)
- ethanol degradation II (3/3 steps found)
- ethanol degradation IV (3/3 steps found)
- putrescine degradation V (2/2 steps found)
- octane oxidation (4/5 steps found)
- superpathway of glycol metabolism and degradation (5/7 steps found)
- ethanol degradation III (2/3 steps found)
- hypotaurine degradation (2/3 steps found)
- putrescine degradation IV (2/3 steps found)
- ethylene glycol degradation (1/2 steps found)
- putrescine degradation I (1/2 steps found)
- L-tryptophan degradation X (mammalian, via tryptamine) (2/4 steps found)
- fatty acid α-oxidation I (plants) (2/4 steps found)
- putrescine degradation III (2/4 steps found)
- serotonin degradation (4/7 steps found)
- histamine degradation (1/3 steps found)
- 3-methyl-branched fatty acid α-oxidation (3/6 steps found)
- noradrenaline and adrenaline degradation (8/13 steps found)
- superpathway of L-arginine and L-ornithine degradation (8/13 steps found)
- dopamine degradation (2/5 steps found)
- mitochondrial NADPH production (yeast) (2/5 steps found)
- superpathway of NAD/NADP - NADH/NADPH interconversion (yeast) (4/8 steps found)
- superpathway of ornithine degradation (4/8 steps found)
- D-arabinose degradation II (1/4 steps found)
- superpathway of L-arginine, putrescine, and 4-aminobutanoate degradation (6/11 steps found)
- Entner-Doudoroff pathway II (non-phosphorylative) (4/9 steps found)
- aromatic biogenic amine degradation (bacteria) (3/8 steps found)
- ceramide degradation by α-oxidation (2/7 steps found)
- sphingosine and sphingosine-1-phosphate metabolism (4/10 steps found)
- alkane oxidation (1/6 steps found)
- limonene degradation IV (anaerobic) (1/7 steps found)
- ceramide and sphingolipid recycling and degradation (yeast) (4/16 steps found)
- superpathway of pentose and pentitol degradation (8/42 steps found)
KEGG Metabolic Maps
- 1,2-Dichloroethane degradation
- 3-Chloroacrylic acid degradation
- Arginine and proline metabolism
- Ascorbate and aldarate metabolism
- Butanoate metabolism
- Fatty acid metabolism
- Glycerolipid metabolism
- Glycolysis / Gluconeogenesis
- Histidine metabolism
- Limonene and pinene degradation
- Lysine degradation
- Propanoate metabolism
- Pyruvate metabolism
- Tryptophan metabolism
- Urea cycle and metabolism of amino groups
- Valine, leucine and isoleucine degradation
- beta-Alanine metabolism
Isozymes
Compare fitness of predicted isozymes for: 1.2.1.3
Use Curated BLAST to search for 1.2.1.3
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Compare to protein structures
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
Find the best match in UniProt
Protein Sequence (99 amino acids)
>GFF3741 Aldehyde dehydrogenase (EC 1.2.1.3) (Hydrogenophaga sp. GW460-11-11-14-LB1) LLPWKDEDDLIAQCNDNMFGLASGIWTRDFKSAWRIGRSLQTGTVWINTYKVFSISTPFT GVKMSGYGQEKGRLGILEYTSQKSFYWGLNESPMPWATS