Protein Info for PS417_19145 in Pseudomonas simiae WCS417

Annotation: membrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 820 transmembrane" amino acids 12 to 37 (26 residues), see Phobius details amino acids 202 to 224 (23 residues), see Phobius details TIGR00229: PAS domain S-box protein" amino acids 245 to 366 (122 residues), 45.7 bits, see alignment E=6.9e-16 PF00989: PAS" amino acids 251 to 360 (110 residues), 47 bits, see alignment E=7.1e-16 PF13188: PAS_8" amino acids 251 to 305 (55 residues), 25.6 bits, see alignment 2.6e-09 PF08448: PAS_4" amino acids 251 to 365 (115 residues), 36.7 bits, see alignment E=1.3e-12 PF13426: PAS_9" amino acids 256 to 362 (107 residues), 38.8 bits, see alignment E=3e-13 TIGR00254: diguanylate cyclase (GGDEF) domain" amino acids 370 to 535 (166 residues), 137.7 bits, see alignment E=3.1e-44 PF00990: GGDEF" amino acids 374 to 532 (159 residues), 147.7 bits, see alignment E=8e-47 PF00563: EAL" amino acids 554 to 793 (240 residues), 204 bits, see alignment E=7.2e-64

Best Hits

KEGG orthology group: None (inferred from 97% identity to pfs:PFLU4308)

Predicted SEED Role

"Sensory box/GGDEF family protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7UCK6 at UniProt or InterPro

Protein Sequence (820 amino acids)

>PS417_19145 membrane protein (Pseudomonas simiae WCS417)
MKQKRTLGTPKLLGIVWPFIAVVLFQALLGCVSLYVLSAVRGYVAGESLWSKGQKDAIYY
LTLYADSRDETTYLKYQQAIAVPQGGHELRTALDRPTPDLSAARLGILKGGNHPDDVSNL
IWLYLNFRHFSYLEKAIELWAVGDGYLMQLDDLAREMHDAITRDQVSANDVRQWKAHIVG
INEGVTPAAKAFSDALGEGSRMILRLLLITNLATALGLIVLALLRTHKLLTQRHAFADAL
QQEKERAQITLESIGDGVITTDVDGAITYMNPAAEALTHWNSAQAQGLPLAALFNLLDDN
AQPDGFTLIEHIVKGQLSGGSEHSKTIQRLDGSTVSVTLVGAPIRSTGKVTGAVLVLHDM
TQERQYIANLSWQATHDALTGLANRREFEFRLEQVLHPTAQQNGGRHALMFLDLDQFKLV
NDTCGHAAGDELLRHICALLQSDLREGDTLARLGGDEFGILLENCPAAVAEKIAESLRHT
VQNLHFVWKGRPFMTTVSIGLVHLGHTPTTLETSLRAADMACYMAKEKGRNRVQVYHADD
SELSLRFGEMAWVQRLHMALEENRFCLYAQEISPLGQTNGGDGHIEILLRLHDEAGRIIL
PDSFIPAAERYGLMTSLDRWVVENVFKIINRCMQERPGLPMAMCAINLSGITIGDDDFLG
FLREKFHTYTIPPGMICFEITETSAIANLGSAIRFINELKALGCHFSLDDFCAGMSSFAY
LKHLPVDFLKIDGSFVKDMLDDPINRAMVEVINHIGHVMGKRTIAEFVETPQIEQALLEI
GVDYAQGYLIERPQLFTFDSLQCRPVRPQPLLFKAPGTFR