Protein Info for GFF3740 in Sphingobium sp. HT1-2

Annotation: Flagellar biosynthesis protein FliR

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 260 transmembrane" amino acids 13 to 34 (22 residues), see Phobius details amino acids 42 to 62 (21 residues), see Phobius details amino acids 73 to 114 (42 residues), see Phobius details amino acids 128 to 154 (27 residues), see Phobius details amino acids 174 to 203 (30 residues), see Phobius details amino acids 213 to 238 (26 residues), see Phobius details PF01311: Bac_export_1" amino acids 14 to 243 (230 residues), 192.2 bits, see alignment E=5.2e-61 TIGR01400: flagellar biosynthetic protein FliR" amino acids 16 to 252 (237 residues), 184.9 bits, see alignment E=9.7e-59

Best Hits

KEGG orthology group: K02421, flagellar biosynthetic protein FliR (inferred from 86% identity to sjp:SJA_C1-30710)

Predicted SEED Role

"Flagellar biosynthesis protein FliR" in subsystem Flagellar motility or Flagellum

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (260 amino acids)

>GFF3740 Flagellar biosynthesis protein FliR (Sphingobium sp. HT1-2)
MIAPGFAGVETQLWIWLIAMIRPGAAFLAAPVFGAPAMPLQLRLILSLALGMAALNSVTI
QLPHDGVASFEGVMLVAGEVLTGLAMGFAVQIGYSAAFVAGEAIANTMGLGFAAMVDPGS
GQGTQAVGQFLSILSTFLLLAMDGHLLLVSFVVQSYKALPPGAAMLSNDAVWHMIQFGGS
LLGAGVTIALPVGFALVLVQIVMGMLARTAPALNLFAVGMPMAVMAGLVLLAMAVPVMGE
GITIALKSGLEQARAISEGR