Protein Info for PS417_19130 in Pseudomonas simiae WCS417

Updated annotation (from data): L-lactate dehydrogenase (cytochrome) (EC 1.1.2.3)
Rationale: Specifically important for utilizing Sodium L-Lactate. Automated validation from mutant phenotype: the predicted function (1.1.2.3) was linked to the condition via a SEED subsystem. This annotation was also checked manually.
Original annotation: lactate dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 376 PF01070: FMN_dh" amino acids 13 to 375 (363 residues), 435.6 bits, see alignment E=7e-135

Best Hits

Swiss-Prot: 97% identical to LLDD_PSEFS: L-lactate dehydrogenase (lldD) from Pseudomonas fluorescens (strain SBW25)

KEGG orthology group: K00101, L-lactate dehydrogenase (cytochrome) [EC: 1.1.2.3] (inferred from 97% identity to pfs:PFLU4305)

MetaCyc: 76% identical to L-lactate dehydrogenase (Escherichia coli K-12 substr. MG1655)
1.1.5.M6 [EC: 1.1.5.M6]; RXN0-7227 [EC: 1.1.5.M6]

Predicted SEED Role

"L-lactate dehydrogenase (EC 1.1.2.3)" in subsystem L-rhamnose utilization or Lactate utilization or Respiratory dehydrogenases 1 (EC 1.1.2.3)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.1.2.3

Use Curated BLAST to search for 1.1.2.3 or 1.1.5.M6

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7UEV1 at UniProt or InterPro

Protein Sequence (376 amino acids)

>PS417_19130 L-lactate dehydrogenase (cytochrome) (EC 1.1.2.3) (Pseudomonas simiae WCS417)
MIISSASDYRAAAKRKLPRFLFDYIDGGAYAEHTLRANSSDLAEISLRQRILRNVDNLSL
KTTLFGQELDMPVILSPVGLTGMYARRGEVQAAKAAANKGIPFCLSTVSVCPIEEVASQS
AQAIWFQLYVLKDRGFMRNALERAQAAGVTTLVFTVDMPTPGARYRDAHSGMSGPFAAQR
RMLQAVTKPQWAFDVGLMGRPHDLGNISKYLGKPTHLEDYIGWLANNFDASISWKDLEWI
REFWKGPMIIKGILDPQDAKDAVSFGADGIVVSNHGGRQLDGVLSTAKALPPIADAVGDD
LTVLVDSGIRSGLDVVRMLALGAKACLLGRATAYALAADGQHGVENLLDIFAKEMRVAMT
LTGVTSIAQIDRSTLV