Protein Info for GFF3736 in Xanthobacter sp. DMC5

Annotation: 7-methyl-GTP pyrophosphatase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 199 PF02545: Maf" amino acids 7 to 193 (187 residues), 135.4 bits, see alignment E=9.6e-44

Best Hits

Swiss-Prot: 57% identical to NTPP_RHOPA: Nucleoside triphosphate pyrophosphatase (RPA0299) from Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009)

KEGG orthology group: K06287, septum formation protein (inferred from 86% identity to xau:Xaut_1828)

Predicted SEED Role

"Septum formation protein Maf" in subsystem Bacterial Cell Division or Bacterial Cytoskeleton

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (199 amino acids)

>GFF3736 7-methyl-GTP pyrophosphatase (Xanthobacter sp. DMC5)
VWRGEQPLVLASKSATRLTLLVHAGVPVETVAADVDERALQEAAGDTDPAGIALMLARAK
ALSGSKAAPGRLVLGADQTLALGPKIYHKPASVEAARNQLFELAGQTHALHSAVAVASDG
VVLFDTVVSAFLTMRPLTEETLASYLAAAGPRVLTSVGAYQLESVGVHLFTRVDGDHFTI
LGLPLLQLLPFFREQGLLP