Protein Info for GFF3735 in Sphingobium sp. HT1-2

Annotation: Flagellar motor switch protein FliM

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 294 PF02154: FliM" amino acids 22 to 201 (180 residues), 75.8 bits, see alignment E=4.4e-25 PF01052: FliMN_C" amino acids 221 to 289 (69 residues), 53.6 bits, see alignment E=1.7e-18

Best Hits

KEGG orthology group: K02416, flagellar motor switch protein FliM (inferred from 75% identity to sch:Sphch_2652)

Predicted SEED Role

"Flagellar motor switch protein FliM" in subsystem Bacterial Chemotaxis or Flagellar motility or Flagellum

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (294 amino acids)

>GFF3735 Flagellar motor switch protein FliM (Sphingobium sp. HT1-2)
MNHVQSFAFGRGDAQAPVMLSGLDRLGEKLGRRIRALIEPISGIRPHVVAEDARVVEFGA
WSAGAPNFCSLSIYRLLPLKGQMLLCMDATMISTLVDCFYGGLGNRALPARGEFTPTEDR
LIARLSETIMARMVECWSEVLPLEPGLLLRETGIGFAAAAQPADQMVVQRFRVGLDRDRE
WSIDMVFPLAALRGVEALMGSKVASDDEHVDPVWQARVARRMRDIRLPARTVLARPNLSL
AELMQLKAGDIIPVTIGRSLPLIVGDRIVAHGTIGEQDGRAAFQIEKIAQGPEQ