Protein Info for GFF3734 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: Bona fide RidA/YjgF/TdcF/RutC subgroup

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 122 PF01042: Ribonuc_L-PSP" amino acids 14 to 121 (108 residues), 79.4 bits, see alignment E=1.1e-26

Best Hits

Swiss-Prot: 34% identical to RUTC_AGRRK: Putative aminoacrylate peracid reductase RutC (rutC) from Agrobacterium radiobacter (strain K84 / ATCC BAA-868)

KEGG orthology group: None (inferred from 76% identity to del:DelCs14_4518)

Predicted SEED Role

"Bona fide RidA/YjgF/TdcF/RutC subgroup"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (122 amino acids)

>GFF3734 Bona fide RidA/YjgF/TdcF/RutC subgroup (Hydrogenophaga sp. GW460-11-11-14-LB1)
MKEIIDVGLPPFKQPFSWMVRAGGVLYTAHGPVREDGSVDTTGSIEQQARLTFSNLQRAV
ERAGKTMDDVAQVLIYMTDVADMPAIDAVYREFFRAPWPNRSSAGVALVVPGMKIEIVAY
VA