Protein Info for GFF3730 in Variovorax sp. SCN45

Annotation: Integral membrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 272 transmembrane" amino acids 7 to 34 (28 residues), see Phobius details amino acids 50 to 71 (22 residues), see Phobius details amino acids 88 to 106 (19 residues), see Phobius details amino acids 113 to 132 (20 residues), see Phobius details amino acids 149 to 174 (26 residues), see Phobius details amino acids 187 to 209 (23 residues), see Phobius details amino acids 222 to 243 (22 residues), see Phobius details amino acids 253 to 271 (19 residues), see Phobius details PF01925: TauE" amino acids 8 to 268 (261 residues), 129.8 bits, see alignment E=6.6e-42

Best Hits

KEGG orthology group: K07090, (no description) (inferred from 66% identity to hel:HELO_1646)

Predicted SEED Role

"Integral membrane protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (272 amino acids)

>GFF3730 Integral membrane protein (Variovorax sp. SCN45)
VSIYLMLAGFGCLAGVTTVLFGFGGGFVVVPLLYRALIAEHGADSATGQSAMHIAVATST
CVMIVSAMLATRRHQRAGTLDWAQVRPLLRPIGAGAVVGAAAAVAADGEFVRWAFIVYLG
ATILDCVFRPGFLAHTAPAVARPLSGQVATFGSFVIGLIAAFLGVGGSVMTVPLMRRRGA
AMTHATAMANPLSLPIALAGTATYMGLAWNSAASLEGWHIGYVDVPAFAALVAGSLIGVR
AAAPLIGRIPDRIHTWVYLGLLVAVLAGMVLR